Basic Vector Information
- Vector Name:
- pLeo665
- Length:
- 3400 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Scheller L, Strittmatter T, Fuchs D, Bojar D, Fussenegger M.
pLeo665 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pLeo665 vector Sequence
LOCUS 40924_28092 3400 bp DNA circular SYN 18-DEC-2018 DEFINITION Expression vector pLeo665, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3400) AUTHORS Scheller L, Strittmatter T, Fuchs D, Bojar D, Fussenegger M. TITLE Generalized extracellular molecule sensor platform for programming cellular behavior JOURNAL Nat. Chem. Biol. 14 (7), 723-729 (2018) PUBMED 29686358 REFERENCE 2 (bases 1 to 3400) AUTHORS Scheller L, Strittmatter T. TITLE Direct Submission JOURNAL Submitted (06-NOV-2017) D-BSSE, ETH Zurich, Mattenstrasse 26, Basel 4058, Switzerland REFERENCE 3 (bases 1 to 3400) TITLE Direct Submission REFERENCE 4 (bases 1 to 3400) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat. Chem. Biol."; date: "2018"; volume: "14"; issue: "7"; pages: "723-729" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (06-NOV-2017) D-BSSE, ETH Zurich, Mattenstrasse 26, Basel 4058, Switzerland" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..3400 /mol_type="other DNA" /organism="synthetic DNA construct" protein_bind 15..285 /label=tetracycline response element /note="contains seven copies of the tetracycline operator tetO" misc_feature 318..442 /label=CMVmin /note="CMVmin" promoter 318..355 /label=minimal CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" sig_peptide 467..526 /label=Ig-kappa leader /note="leader sequence from mouse immunoglobulin kappa light chain" CDS 545..1057 /codon_start=1 /label=Nluc /note="NanoLuc(R) luciferase" /translation="MVFTLEDFVGDWRQTAGYNLDQVLEQGGVSSLFQNLGVSVTPIQR IVLSGENGLKIDIHVIIPYEGLSGDQMGQIEKIFKVVYPVDDHHFKVILHYGTLVIDGV TPNMIDYFGRPYEGIAVFDGKKITVTGTLWNGNKIIDERLINPDGSLLFRVTINGVTGW RLCERILA" polyA_signal complement(1087..1221) /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin complement(1583..2171) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(2638..3016) /label=ISS /note="immunostimulatory sequence from the AmpR gene; contains unmethylated CpG dinucleotides in the context of 5'-AACGTT-3' (Sato et al., 1996)" promoter complement(3201..3305) /label=AmpR promoter
This page is informational only.