Basic Vector Information
- Vector Name:
- pL1E-lc
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4472 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Hochrein L, Machens F, Gremmels J, Schulz K, Messerschmidt K, Mueller-Roeber B.
- Promoter:
- SNR52
pL1E-lc vector Map
pL1E-lc vector Sequence
LOCUS 40924_27464 4472 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector pL1E-lc, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 4472)
AUTHORS Hochrein L, Machens F, Gremmels J, Schulz K, Messerschmidt K,
Mueller-Roeber B.
TITLE AssemblX: a user-friendly toolkit for rapid and reliable multi-gene
assemblies
JOURNAL Nucleic Acids Res. (2017) In press
PUBMED 28130422
REFERENCE 2 (bases 1 to 4472)
AUTHORS Hochrein L, Machens F, Gremmels J, Schulz K, Messerschmidt K,
Mueller-Roeber B.
TITLE Direct Submission
JOURNAL Submitted (11-NOV-2016) Department of Molecular Biology - Cell2Fab
research unit, University of Potsdam, Karl-Liebknecht-Str. 24-25,
Potsdam, Brandenburg 14476, Germany
REFERENCE 3 (bases 1 to 4472)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 4472)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nucleic
Acids Res. (2017) In press"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(11-NOV-2016) Department of Molecular Biology - Cell2Fab research
unit, University of Potsdam, Karl-Liebknecht-Str. 24-25, Potsdam,
Brandenburg 14476, Germany"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..4472
/mol_type="other DNA"
/organism="synthetic DNA construct"
rep_origin complement(64..652)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(826..1683)
/codon_start=1
/label=AmpR
/note="beta-lactamase"
/translation="[TEM beta-lactamase fragment, 45 aa]
ELDLNSGKILESFRPEERFPMMSTFKVLLCDTLLSRIDAGQEQLGRRIHYSQNDLVEYS
[TEM beta-lactamase fragment, 59 aa]
EPELNEAIPNDESDTTMPVAMPTTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
LPAGWFIADKSGAGERGSRGIIAALGPDGKRSRIVVIYTTGSQATMDERNRQIAEIGAS
LIKHW"
misc_feature complement(1781..2284)
/label=CEN/ARS
/note="S. cerevisiae CEN6 centromere fused to an
autonomously replicating sequence"
promoter 2545..2813
/label=SNR52 promoter
/note="promoter for the S. cerevisiae small nucleolar RNA
gene SNR52"
misc_RNA 2822..2896
/label=gRNA scaffold
/note="guide RNA scaffold for the Streptococcus pyogenes
CRISPR/Cas9 system"
terminator 2901..2920
/label=SUP4 terminator
/note="transcription terminator for the S. cerevisiae SUP4
tRNA gene"
terminator 2972..3161
/label=CYC1 terminator
/note="transcription terminator for CYC1"
misc_feature 3380..3397
/label=I-SceI
/note="I-SceI"
misc_feature 3398..3447
/label=homology region E0*
/note="homology region E0*"
CDS 3456..4127
/codon_start=1
/label=TRP1
/note="phosphoribosylanthranilate isomerase, required for
tryptophan biosynthesis"
/translation="MSVINFTGSSGPLVKVCGLQSTEAAECALDSDADLLGIICVPNRK
RTIDPVIARKISSLVKAYKNSSGTPKYLVGVFRNQPKEDVLALVNDYGIDIVQLHGDES
WQEYQEFLGLPVIKRLVFPKDCNILLSAASQKPHSFIPLFDSEAGGTGELLDWNSISDW
VGRQESPESLHFMLAGGLTPENVGDALRLNGVIGVDVSGGVETNGVKDSNKIANFVKNA
KK"
misc_feature 4227..4276
/label=homology region F0*
/note="homology region F0*"
misc_feature 4277..4294
/label=I-SceI
/note="I-SceI"
This page is informational only.