LITMUS39 vector (V012560)

Basic Vector Information

      • Vector Name:
      • LITMUS39
      • Antibiotic Resistance:
      • Ampicillin
      • Length:
      • 2817 bp
      • Type:
      • Cloning Vectors
      • Source/Author:
      • Evans PD, Cook SN, Riggs PD, Noren CJ.
      • Copy Number:
      • High copy number
      • 5' Primer:
      • M13 fwd
      • 3' Primer:
      • M13 rev

LITMUS39 vector Vector Map

LITMUS392817 bp600120018002400AmpR promoterAmpRM13 oriorilac promoterlac operatorM13 rev

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

LITMUS39 vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported                2817 bp ds-DNA    circular SYN 25-11-2013
DEFINITION  High copy-number E. coli vector with a multiple cloning site flanked
            by mutant T7 promoters. The MCS is reversed relative to LITMUS38.
ACCESSION   .
VERSION     .
KEYWORDS    LITMUS39
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 2817)
  AUTHORS   Evans PD, Cook SN, Riggs PD, Noren CJ.
  TITLE     LITMUS: multipurpose cloning vectors with a novel system for 
            bidirectional in vitro transcription.
  JOURNAL   BioTechniques 1995;19:130-5.
  PUBMED    7669286
REFERENCE   2  (bases 1 to 2817)
  AUTHORS   New England Biolabs
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..2817
                     /organism="synthetic DNA construct"
                     /lab_host="Escherichia coli"
                     /mol_type="other DNA"
     promoter        38..142
                     /gene="bla"
                     /note="AmpR promoter"
     CDS             143..1003
                     /codon_start=1
                     /gene="bla"
                     /product="beta-lactamase"
                     /note="AmpR"
                     /note="confers resistance to ampicillin, carbenicillin, and
                     related antibiotics"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
                     ELDLNSGKILESFRPEERSPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
                     LIKHW"
     rep_origin      complement(1045..1554)
                     /direction=LEFT
                     /note="M13 ori"
                     /note="M13 bacteriophage origin of replication; arrow 
                     indicates direction of (+) strand synthesis"
     rep_origin      1665..2253
                     /direction=RIGHT
                     /note="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     promoter        2350..2380
                     /note="lac promoter"
                     /note="promoter for the E. coli lac operon"
     protein_bind    2388..2404
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="lac operator"
                     /note="The lac repressor binds to the lac operator to 
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     2412..2428
                     /note="M13 rev"
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     CDS             2424..2789
                     /codon_start=1
                     /gene="lacZalpha"
                     /product="LacZ-alpha fragment of beta-galactosidase"
                     /note="lacZ-alpha"
                     /translation="MTMITPSYVIRLTSGSTACLYTPEDAFGRASEFWIHDILQEAFWR
                     LAGAIEWAPLVKALSESYYGLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTD
                     RPSQQLRSLNGEWRFAW"
     promoter        2449..2466
                     /gene="lacZalpha"
                     /note="T7 promoter (mutant)"
                     /note="mutant version of the promoter for bacteriophage T7 
                     RNA polymerase"
     misc_feature    2460..2602
                     /gene="lacZalpha"
                     /note="MCS"
                     /note="multiple cloning site"
     promoter        complement(2597..2614)
                     /note="T7 promoter (mutant)"
                     /note="mutant version of the promoter for bacteriophage T7 
                     RNA polymerase"
     primer_bind     complement(2618..2634)
                     /note="M13 fwd"
                     /note="common sequencing primer, one of multiple similar 
                     variants"

This page is informational only.