pBC SK(+) vector (Cat. No.: V012549)
Basic Information
- Name:
- pBC SK(+)
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 3400 bp
- Type:
- Cloning Vectors
- Replication origin:
- ori
- Source/Author:
- Agilent Technologies
- Copy Number:
- High copy number
- 5' Primer:
- M13 fwd
- 3' Primer:
- M13 rev
pBC SK(+) vector (Cat. No.: V012549) Sequence
LOCUS 40924_6107 3400 bp DNA circular SYN 01-JAN-1980
DEFINITION Phagemid vector derived from pBluescript II SK(+), with a
chloramphenicol resistance gene. The MCS is reversed relative to pBC
KS(+).
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 3400)
AUTHORS Agilent Technologies
TITLE Direct Submission
REFERENCE 2 (bases 1 to 3400)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..3400
/mol_type="other DNA"
/organism="synthetic DNA construct"
rep_origin complement(3..458)
/direction=LEFT
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
primer_bind 600..616
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
promoter 626..644
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
misc_feature complement(653..760)
/label=MCS
/note="pBluescript multiple cloning site"
promoter complement(773..791)
/label=T3 promoter
/note="promoter for bacteriophage T3 RNA polymerase"
primer_bind complement(812..828)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(836..852)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(860..890)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(905..926)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(1214..1802)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
promoter 2022..2124
/label=cat promoter
/note="promoter of the E. coli cat gene encoding
chloramphenicol acetyltransferase"
CDS 2125..2781
/codon_start=1
/label=CmR
/note="chloramphenicol acetyltransferase"
/translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
KTVKKNKHKFYPAFIHILARLMNAHPELRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
promoter complement(3272..3377)
/label=AmpR promoter
This page is informational only.