pEX-C-GST vector (Cat. No.: V012523)
Note: The pEX-C-GST is a bacterial vector for the inducible expression of a protein with a cleavable C-terminal GST tag.The plasmid can be expressed in E.coli (BL21/DE3)
- Name:
- pEX-C-GST
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5253 bp
- Type:
- Cloning Vectors
- Replication origin:
- ori
- Source/Author:
- OriGene
- Copy Number:
- High copy number
Resources
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add sterile water to dissolve the DNA: add 20 μl for 5 μg plasmid, and 100 μl for 100 μg plasmid.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
References
- Bochler A, Querido JB, Prilepskaja T, Soufari H, Simonetti A, Del Cistia ML, Kuhn L, Ribeiro AR, Valášek LS, Hashem Y. Structural Differences in Translation Initiation between Pathogenic Trypanosomatids and Their Mammalian Hosts. Cell Rep. 2020 Dec 22;33(12):108534.
pEX-C-GST vector (Cat. No.: V012523) Sequence
LOCUS pEX-C-GST 5253 bp DNA circular SYN 29-DEC-2025
DEFINITION PrecisionShuttle(TM) bacterial vector for inducible expression of a
protein with a cleavable C-terminal GST tag.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 5253)
AUTHORS OriGene
TITLE Direct Submission
REFERENCE 2 (bases 1 to 5253)
TITLE Direct Submission
REFERENCE 3 (bases 1 to 5253)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"
COMMENT SGRef: number: 2; type: "Journal Article"
COMMENT Inserts are typically cloned between the BseRI and MluI sites. The
BseRI site is compatible with SgfI sites from other
PrecisionShuttle(TM) vectors.
FEATURES Location/Qualifiers
source 1..5253
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 216..234
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
protein_bind 235..259
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
RBS 263..285
/label=RBS
/note="efficient ribosome binding site from bacteriophage
T7 gene 10 (Olins and Rangwala, 1989)"
misc_feature 286..361
/label=MCS
/note="MCS"
/note="multiple cloning site"
CDS 362..382
/label=TEV site
/note="tobacco etch virus (TEV) protease recognition and
cleavage site"
CDS 383..1036
/label=GST
/note="glutathione S-transferase from Schistosoma
japonicum"
CDS 1058..1078
/label=TEV site
/note="tobacco etch virus (TEV) protease recognition and
cleavage site"
terminator 1169..1215
/note="T7 terminator"
/note="transcription terminator for bacteriophage T7 RNA
polymerase"
promoter 1461..1538
/label=lacI promoter
CDS 1539..2618
/codon_start=1
/label=lacI
/note="lac repressor"
/translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL
NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV
EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH
EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA
MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC
YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR
ALADSLMQLARQVSRLESGQ"
protein_bind 2634..2655
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
promoter 2670..2700
/label=lac promoter
/note="promoter for the E. coli lac operon"
primer_bind 2732..2748
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
primer_bind complement(2764..2780)
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
rep_origin complement(3072..3660)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(3834..4691)
/label=AmpR
/note="beta-lactamase"
promoter complement(4692..4796)
/label=AmpR promoter
rep_origin 4823..5253
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"