Basic Vector Information
- Vector Name:
- pHSG398
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 2227 bp
- Type:
- Cloning Vectors
- Replication origin:
- ori
- Source/Author:
- Takeshita S, Sato M, Toba M, Masahashi W, Hashimoto-Gotoh T.
- Copy Number:
- High copy number
- 5' Primer:
- M13 fwd
- 3' Primer:
- M13 rev
pHSG398 vector Map
pHSG398 vector Sequence
LOCUS 40924_25081 2227 bp DNA circular SYN 01-JAN-1980
DEFINITION pUC-type bacterial cloning vector with a chloramphenicol resistance
gene. The MCS is similar but reversed in pHSG396.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 2227)
AUTHORS Takeshita S, Sato M, Toba M, Masahashi W, Hashimoto-Gotoh T.
TITLE High-copy-number and low-copy-number plasmid vectors for lacZ
alpha-complementation and chloramphenicol- or kanamycin-resistance
selection.
JOURNAL Gene 1987;61:63-74.
PUBMED 3327753
REFERENCE 2 (bases 1 to 2227)
AUTHORS TaKaRa
TITLE Direct Submission
REFERENCE 3 (bases 1 to 2227)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Gene";
date: "1987"; volume: "61"; pages: "63-74"
COMMENT SGRef: number: 2; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..2227
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 90..192
/label=cat promoter
/note="promoter of the E. coli cat gene encoding
chloramphenicol acetyltransferase"
CDS 193..849
/codon_start=1
/label=CmR
/note="chloramphenicol acetyltransferase"
/translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
protein_bind 1060..1081
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
promoter 1096..1126
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind 1134..1150
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
primer_bind 1158..1174
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
misc_feature 1184..1240
/label=MCS
/note="pUC18/19 multiple cloning site"
primer_bind complement(1244..1260)
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
rep_origin complement(1586..2174)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
This page is informational only.