Price Information
| Cat No. | Plasmid Name | Availability | Buy one, get one free! (?) |
|---|---|---|---|
| V012415 | pSB1C3 | In stock, instant shipping |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
pSB1C3 is a high copy BioBrick assembly plasmid with a chloramphenicol resistance marker.
- Vector Name:
- pSB1C3
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 2070 bp
- Type:
- Cloning Vectors
- Replication origin:
- ori
- Source/Author:
- iGEM
- Copy Number:
- High copy number
- Growth Strain(s):
- Stbl3
- Growth Temperature:
- 37℃
pSB1C3 vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
References
- Skrlj N, Erculj N, Dolinar M. A versatile bacterial expression vector based on the synthetic biology plasmid pSB1. Protein Expr Purif. 2009 Apr;64(2):198-204.
pSB1C3 vector Sequence
LOCUS 40924_38723 2070 bp DNA circular SYN 01-JAN-1980
DEFINITION High copy BioBrick assembly plasmid with a chloramphenicol
resistance marker, for shipping parts to the Registry of Standard
Biological Parts.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 2070)
AUTHORS iGEM
TITLE Direct Submission
REFERENCE 2 (bases 1 to 2070)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..2070
/mol_type="other DNA"
/organism="synthetic DNA construct"
misc_feature 1..21
/label=BioBrick suffix
/note="universal suffix for all parts"
terminator 22..79
/label=his operon terminator
/note="This putative transcriptin terminator from the E.
coli his operon has a 2-bp deletion introduced during
synthesis. Its efficiency has not been determined."
rep_origin complement(274..862)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
terminator complement(1045..1139)
/label=lambda t0 terminator
/note="transcription terminator from phage lambda"
CDS complement(1163..1819)
/codon_start=1
/label=CmR
/note="chloramphenicol acetyltransferase"
/translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
promoter complement(1820..1923)
/label=cat promoter
/note="promoter of the E. coli cat gene encoding
chloramphenicol acetyltransferase"
terminator complement(2003..2046)
/label=bacterial terminator
/note="putative bacterial transcription terminator"
misc_feature 2049..2070
/label=BioBrick prefix
/note="BioBrick prefix for parts that do not start with
'ATG'"