Basic Vector Information
- Vector Name:
- pCFD3-dU6:3gRNA
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6365 bp
- Type:
- CRISPR Plasmids
- Replication origin:
- ori
- Source/Author:
- Port F, Chen HM, Lee T, Bullock SL.
- Copy Number:
- High copy number
- Promoter:
- dU6-3
pCFD3-dU6:3gRNA vector Map
pCFD3-dU6:3gRNA vector Sequence
LOCUS pCFD3-dU6-3gRNA. 6365 bp DNA circular SYN 01-JAN-1980
DEFINITION Drosophila expression vector in which a guide RNA (gRNA) is
expressed from the U6-3 promoter.
ACCESSION .
VERSION .
KEYWORDS pCFD3-dU6-3gRNA
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 6365)
AUTHORS Port F, Chen HM, Lee T, Bullock SL.
TITLE Optimized CRISPR/Cas tools for efficient germline and somatic genome
engineering in Drosophila.
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 2014;111:E2967-76.
PUBMED 25002478
REFERENCE 2 (bases 1 to 6365)
AUTHORS Bullock Lab / Addgene #49410
TITLE Direct Submission
REFERENCE 3 (bases 1 to 6365)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Proc. Natl.
Acad. Sci. U.S.A."; date: "2014"; volume: "111"; pages: "E2967-76"
COMMENT SGRef: number: 2; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..6365
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 7..427
/label=dU6-3 promoter
/note="RNA polymerase III promoter for Drosophila U6-3
snRNA (Port et al., 2014)"
misc_RNA 446..521
/label=gRNA scaffold
/note="guide RNA scaffold for the Streptococcus pyogenes
CRISPR/Cas9 system"
terminator 522..527
/note="polIII terminator"
/note="RNA polymerase III transcription terminator"
promoter complement(832..850)
/label=T3 promoter
/note="promoter for bacteriophage T3 RNA polymerase"
primer_bind complement(871..887)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(895..911)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(919..949)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(964..985)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(1273..1861)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(2035..2892)
/label=AmpR
/note="beta-lactamase"
promoter complement(2893..2997)
/label=AmpR promoter
rep_origin complement(3023..3478)
/direction=LEFT
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
primer_bind 3620..3636
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
promoter 3643..3661
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
CDS complement(join(3853..3970,4047..4140,4232..4838,4893..5026,
5087..5247,5321..5346))
/codon_start=1
/product="tryptophan oxygenase"
/label=tryptophan oxygenase
/note="vermilion"
/note="selectable marker, required to synthesize the brown
eye pigment in Drosophila"
/translation="MSCPYAGNGNDHDDSAVPLTTEVGKIYGEYLMLDKLLDAQCMLSE
EDKRPVHDEHLFIITHQAYELWFKQIIFEFDSIRDMLDAEVIDETKTLEIVKRLNRVVL
ILKLLVDQVPILETMTPLDFMDFRKYLAPASGFQSLQFRLIENKLGVLTEQRVRYNQKY
SDVFSDEEARNSIRNSEKDPSLLELVQRWLERTPGLEESGFNFWAKFQESVDRFLEAQV
QSAMEEPVEKAKNYRLMDIEKRREVYRSIFDPAVHDALVRRGDRRFSHRALQGAIMITF
YRDEPRFSQPHQLLTLLMDIDSLITKWRYNHVIMVQRMIGSQQLGTGGSSGYQYLRSTL
SDRYKVFLDLFNLSTFLIPREAIPPLDETIRKKLINKSV"
protein_bind 5661..5730
/label=attB
/note="attB site for the phi-C31 integrase (Groth et al.,
2000)"
protein_bind 5973..6358
/label=gypsy insulator
/note="chromatin insulator from Drosophila"
This page is informational only.