Price Information
Cat No. | Plasmid Name | Availability | Add to cart |
---|---|---|---|
V012021 | pEGFP-N1 | In stock (lyophilized plasmid) |
Buy one, get one free! |
Two vials of lyophilized plasmid will be delivered, each vial is about 5µg.
Basic Vector Information
The pEGFP-N1 is a vector for fusing EGFP to the C-terminus of a partner protein.
- Vector Name:
- pEGFP-N1
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4733 bp
- Type:
- Fluorescent Protein Genes & Plasmids
- Replication origin:
- ori
- Source/Author:
- Clontech
- Selection Marker:
- Neomycin/G418(Geneticin)
- Copy Number:
- High copy number
- Promoter:
- CMV
- Cloning Method:
- Enzyme Cut
- Growth Strain(s):
- JM108
- Growth Temperature:
- 37℃
- Expression Method:
- Transient
pEGFP-N1 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
References
- Payán-Bravo L, Fontalva S, Peñate X, Cases I, Guerrero-Martínez JA, Pareja-Sánchez Y, Odriozola-Gil Y, Lara E, Jimeno-González S, Suñé C, Muñoz-Centeno MC, Reyes JC, Chávez S. Human prefoldin modulates co-transcriptional pre-mRNA splicing. Nucleic Acids Res. 2021 Jun 21;49(11):6267-6280. doi: 10.1093/nar/gkab446
- Medlej A, Mohammad Soltani B, Javad Mowla S, Hosseini S, Baharvand H. A novel miRNA located in the GATA4 gene regulates the expression of IGF-1R and AKT1/2 genes and controls cell proliferation. J Cell Biochem. 2020;121(5-6):3438-3450. doi:10.1002/jcb.29617
- Asselin L, Rivera Alvarez J, Heide S, et al. Mutations in the KIF21B kinesin gene cause neurodevelopmental disorders through imbalanced canonical motor activity. Nat Commun. 2020;11(1):2441. doi:10.1038/s41467-020-16294-6
- Kim HJ, Kim HJ, Kim MK, et al. SPSB1 enhances ovarian cancer cell survival by destabilizing p21. Biochem Biophys Res Commun. 2019;510(3):364-369 https://doi.org/10.1016/j.bbrc.2019.01.088
- Namyanja, Monica & Xu, Zhi-Shen & Mugasa, Claire & Lun, Zhao-Rong & Matovu, Enock & Chen, Zhengjun & Lubega, George. (2019). Preliminary evaluation of a Trypanosoma brucei FG-GAP repeat containing protein of mitochondrial localization. AAS Open Research. 2. 165. 10.12688/aasopenres.12986.1. https://aasopenresearch.org/articles/2-165
- Abildgaard AB, Stein A, Nielsen SV, et al. Computational and cellular studies reveal structural destabilization and degradation of MLH1 variants in Lynch syndrome. Elife. 2019 https://doi.org/10.7554/eLife.49138
pEGFP-N1 vector Sequence
LOCUS 40924_17189 4733 bp DNA circular SYN 01-JAN-1980 DEFINITION Vector for fusing EGFP to the C-terminus of a partner protein. For other reading frames, use pEGFP-N2 or pEGFP-N3. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4733) AUTHORS Clontech TITLE Direct Submission REFERENCE 2 (bases 1 to 4733) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" FEATURES Location/Qualifiers source 1..4733 /mol_type="other DNA" /organism="synthetic DNA construct" enhancer 61..364 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 365..568 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" misc_feature 591..671 /label=MCS /note="multiple cloning site" CDS 679..1395 /codon_start=1 /label=EGFP /note="enhanced GFP" /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL EFVTAAGITLGMDELYK" polyA_signal 1521..1642 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin complement(1649..2104) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 2131..2235 /label=AmpR promoter promoter 2237..2594 /label=SV40 promoter /note="SV40 enhancer and early promoter" CDS 2629..3420 /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF" polyA_signal 3655..3702 /label=HSV TK poly(A) signal /note="herpes simplex virus thymidine kinase polyadenylation signal (Cole and Stacy, 1985)" rep_origin 4031..4619 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"