Basic Vector Information
- Vector Name:
- pPA-TagRFP-C
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4725 bp
- Type:
- Fluorescent Protein Genes & Plasmids
- Replication origin:
- ori
- Source/Author:
- Evrogen
- Selection Marker:
- Neomycin/G418(Geneticin)
- Copy Number:
- High copy number
- Promoter:
- CMV
pPA-TagRFP-C vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pPA-TagRFP-C vector Sequence
LOCUS 40924_34032 4725 bp DNA circular SYN 01-JAN-1980 DEFINITION Vector for fusing photoactivatable TagRFP to the N-terminus of a partner protein. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4725) AUTHORS Evrogen TITLE Direct Submission REFERENCE 2 (bases 1 to 4725) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" FEATURES Location/Qualifiers source 1..4725 /mol_type="other DNA" /organism="synthetic DNA construct" enhancer 61..364 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 365..568 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" CDS 625..1311 /codon_start=1 /label=PA-TagRFP /note="photoactivatable variant of the monomeric red fluorescent protein TagRFP (Subach et al., 2010)" /translation="ELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVE GGPLPFAFDILATSFMYGSSTFINHTQGIPDFWKQSFPEGFTWERVTTYEDGGVLTATQ DTSLQDGCLIYNVKIRGVNFPSNGPVMKKKTLGWEPSTEKLKPADGGLEGRVDMALKLV GGGHLICNFKTTYRSKKPAKNLKMPGVYYVDRRLEIIKEADKETYWEQHEVAVARYSDL PSKLGHR" misc_feature 1324..1389 /label=MCS /note="multiple cloning site" polyA_signal 1513..1634 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin complement(1641..2096) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 2123..2227 /label=AmpR promoter promoter 2229..2586 /label=SV40 promoter /note="SV40 enhancer and early promoter" CDS 2621..3412 /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF" polyA_signal 3647..3694 /label=HSV TK poly(A) signal /note="herpes simplex virus thymidine kinase polyadenylation signal (Cole and Stacy, 1985)" rep_origin 4023..4611 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.