Price Information
Cat No. | Plasmid Name | Availability | Add to cart |
---|---|---|---|
V011927 | pTagYFP-C | In stock (lyophilized plasmid) |
Buy one, get one free! |
Two vials of lyophilized plasmid will be delivered, each vial is about 5µg.
Basic Vector Information
pTagYFP-C is a vector for fusing TagYFP to the N-terminus of a partner protein.
- Vector Name:
- pTagYFP-C
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4731 bp
- Type:
- Fluorescent Protein Genes & Plasmids
- Replication origin:
- ori
- Source/Author:
- Evrogen
- Selection Marker:
- Neomycin/G418(Geneticin)
- Copy Number:
- High copy number
pTagYFP-C vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
References
- Zhang JZ, Termglinchan V, Shao NY, Itzhaki I, Liu C, Ma N, Tian L, Wang VY, Chang ACY, Guo H, Kitani T, Wu H, Lam CK, Kodo K, Sayed N, Blau HM, Wu JC. A Human iPSC Double-Reporter System Enables Purification of Cardiac Lineage Subpopulations with Distinct Function and Drug Response Profiles. Cell Stem Cell. 2019 May 2;24(5):802-811.e5.
pTagYFP-C vector Sequence
LOCUS 40924_42599 4731 bp DNA circular SYN 01-JAN-1980 DEFINITION Vector for fusing TagYFP to the N-terminus of a partner protein. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4731) AUTHORS Evrogen TITLE Direct Submission REFERENCE 2 (bases 1 to 4731) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" FEATURES Location/Qualifiers source 1..4731 /mol_type="other DNA" /organism="synthetic DNA construct" enhancer 61..364 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 365..568 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" CDS 613..1329 /codon_start=1 /label=TagYFP /note="monomeric yellow fluorescent protein" /translation="MVSKGEELFAGIVPVLIELDGDVHGHKFSVRGEGEGDADYGKLEI KFICTTGKLPVPWPTLVTTLTYGVQCFARYPKHMKMNDFFKSAMPEGYIQERTILFQDD GKYKTRGEVKFEGDTLVNRIELKGKDFKEDGNILGHKLEYSFNSHNVYITPDKANNGLE VNFKTRHNIEGGGVQLADHYQTNVPLGDGPVLIPINHYLSYQTDISKDRNEARDHMVLL ESVSACSHTHGMDELYR" misc_feature 1330..1395 /label=MCS /note="multiple cloning site" polyA_signal 1519..1640 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin complement(1647..2102) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 2129..2233 /label=AmpR promoter promoter 2235..2592 /label=SV40 promoter /note="SV40 enhancer and early promoter" CDS 2627..3418 /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF" polyA_signal 3653..3700 /label=HSV TK poly(A) signal /note="herpes simplex virus thymidine kinase polyadenylation signal (Cole and Stacy, 1985)" rep_origin 4029..4617 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"