Basic Vector Information
- Vector Name:
- pHELLSGATE 4
- Antibiotic Resistance:
- Kanamycin
- Length:
- 17861 bp
- Type:
- Gateway Cloning Vectors
- Replication origin:
- oriV
- Host:
- Plants
- Source/Author:
- Helliwell CA, Wesley SV, Wielopolska AJ, Waterhouse PM.
- Copy Number:
- High copy number
- Promoter:
- CaMV 35S
pHELLSGATE 4 vector Map
pHELLSGATE 4 vector Sequence
LOCUS pHELLSGATE_4. 17861 bp DNA circular SYN 01-JAN-1980
DEFINITION Improved high-throughput binary Gateway(R) donor vector for
silencing genes in plants using intron-containing hairpin RNA.
ACCESSION .
VERSION .
KEYWORDS pHELLSGATE 4
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 17861)
AUTHORS Helliwell CA, Wesley SV, Wielopolska AJ, Waterhouse PM.
TITLE High-throughput vectors for efficient gene silencing in plants.
JOURNAL Funct. Plant Biol. 2002;29:1217-25.
REFERENCE 2 (bases 1 to 17861)
TITLE Direct Submission
REFERENCE 3 (bases 1 to 17861)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Funct.
Plant Biol."; date: "2002"; volume: "29"; pages: "1217-25"
COMMENT SGRef: number: 2; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..17861
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter complement(65..83)
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
primer_bind complement(90..106)
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
promoter 264..447
/label=NOS promoter
/note="nopaline synthase promoter"
CDS 448..1266
/label=KanR
/note="fusion between an N-terminal peptide of nopaline
synthase and Tn5 aminoglycoside phosphotransferase"
terminator 1894..2146
/label=NOS terminator
/note="nopaline synthase terminator and poly(A) signal"
misc_feature complement(2268..2292)
/label=LB T-DNA repeat
/note="left border repeat from nopaline C58 T-DNA"
oriT 2846..2955
/label=oriT
/note="incP origin of transfer"
mobile_element 3015..3782
/label=IS1
/note="prokaryotic transposable element"
CDS 3782..4132
/label=traJ
/note="oriT-recognizing protein"
CDS 4407..5552
/label=trfA
/note="trans-acting replication protein that binds to and
activates oriV"
rep_origin complement(6915..7503)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS 8600..9388
/codon_start=1
/gene="aadA"
/product="aminoglycoside adenylyltransferase"
/label=aadA
/note="SmR"
/note="confers resistance to spectinomycin and
streptomycin"
/translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH
SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK
RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF
EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP
VILEARQAYLGQEDRLASRADQLEEFVHYVKGEITKVVGK"
rep_origin complement(9993..10705)
/direction=LEFT
/label=oriV
/note="incP origin of replication"
misc_feature complement(11182..11206)
/label=RB T-DNA repeat
/note="right border repeat from nopaline C58 T-DNA"
protein_bind 11462..11483
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
promoter 11498..11528
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind 11536..11552
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
primer_bind 11560..11576
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
promoter 11594..11612
/label=SP6 promoter
/note="promoter for bacteriophage SP6 RNA polymerase"
promoter 12672..13017
/label=CaMV 35S promoter
/note="strong constitutive promoter from cauliflower mosaic
virus"
protein_bind 13048..13279
/label=attP1
/note="recombination site for the Gateway(R) BP reaction"
CDS complement(13678..13980)
/label=ccdB
/note="CcdB, a bacterial toxin that poisons DNA gyrase"
protein_bind complement(14387..14618)
/label=attP2
/note="recombination site for the Gateway(R) BP reaction
(pDONR(TM)221 version)"
misc_feature 14644..14654
/label=MCS 1
/note="MCS 1"
/note="multiple cloning site 1"
intron 14662..15428
/label=PDK intron
/note="pyruvate orthophosphate dikinase intron from
Flaveria trinervia"
misc_feature 15448..15454
/label=MCS 2
/note="MCS 2"
/note="multiple cloning site 2"
protein_bind 15490..15721
/label=attP2
/note="recombination site for the Gateway(R) BP reaction
(pDONR(TM)221 version)"
CDS complement(16028..16330)
/label=ccdB
/note="CcdB, a bacterial toxin that poisons DNA gyrase"
protein_bind complement(16829..17060)
/label=attP1
/note="recombination site for the Gateway(R) BP reaction"
terminator 17092..17798
/label=OCS terminator
/note="octopine synthase terminator"
promoter complement(17839..17857)
/label=SP6 promoter
/note="promoter for bacteriophage SP6 RNA polymerase"
This page is informational only.