Basic Vector Information
- Vector Name:
- pMetLuc-Mem Control
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4764 bp
- Type:
- Luciferase Vectors
- Replication origin:
- ori
- Source/Author:
- Clontech
- Selection Marker:
- Neomycin/G418(Geneticin)
- Copy Number:
- High copy number
- Promoter:
- CMV
pMetLuc-Mem Control vector Map
pMetLuc-Mem Control vector Sequence
LOCUS pMetLuc-Mem_Cont 4764 bp DNA circular SYN 01-JAN-1980
DEFINITION In vivo imaging vector for the constitutive expression of
membrane-anchored Metridia luciferase.
ACCESSION .
VERSION .
KEYWORDS pMetLuc-Mem Control
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 4764)
AUTHORS Clontech
TITLE Direct Submission
REFERENCE 2 (bases 1 to 4764)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..4764
/mol_type="other DNA"
/organism="synthetic DNA construct"
enhancer 61..364
/label=CMV enhancer
/note="human cytomegalovirus immediate early enhancer"
promoter 365..568
/label=CMV promoter
/note="human cytomegalovirus (CMV) immediate early
promoter"
CDS 597..599
/codon_start=1
/product="start codon"
/label=start codon
/note="ATG"
/translation="M"
CDS 603..788
/codon_start=1
/product="signal-anchor region of the transferrin receptor"
/label=signal-anchor region of the transferrin receptor
/note="TfR membrane anchor"
/translation="VDGDNSHVEMKLAVDEEENADNNTKANVTKPKRCSGSICYGTIAV
IVFFLIGFMIGYLGYCK"
CDS 822..1427
/codon_start=1
/product="Metridia luciferase"
/label=Metridia luciferase
/note="MetLuc"
/note="human codon-optimized"
/translation="KSTEFDPNIDIVGLEGKFGITNLETDLFTIWETMEVMIKADIADT
DRASNFVATETDANRGKMPGKKLPLAVIMEMEANAFKAGCTRGCLICLSKIKCTAKMKV
YIPGRCHDYGGDKKTGQAGIVGAIVDIPEISGFKEMAPMEQFIAQVDRCASCTTGCLKG
LANVKCSELLKKWLPDRCASFADKIQKEVHNIKGMAGDR"
polyA_signal 1552..1673
/label=SV40 poly(A) signal
/note="SV40 polyadenylation signal"
rep_origin complement(1680..2135)
/direction=LEFT
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
promoter 2162..2266
/label=AmpR promoter
promoter 2268..2625
/label=SV40 promoter
/note="SV40 enhancer and early promoter"
CDS 2660..3451
/label=NeoR/KanR
/note="aminoglycoside phosphotransferase"
polyA_signal 3686..3733
/label=HSV TK poly(A) signal
/note="herpes simplex virus thymidine kinase
polyadenylation signal (Cole and Stacy, 1985)"
rep_origin 4062..4650
/direction=RIGHT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
This page is informational only.