Basic Vector Information
- Vector Name:
- pHet-1
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5329 bp
- Type:
- Mammalian Expression Vectors
- Replication origin:
- ori
- Source/Author:
- Clontech
- Copy Number:
- High copy number
- Promoter:
- SV40
pHet-1 vector Map
pHet-1 vector Sequence
LOCUS pHet-1. 5329 bp DNA circular SYN 01-JAN-1980
DEFINITION Mammalian vector encoding an FRB heterodimerizer domain, for
creating soluble fusion proteins that can be dimerized with a drug.
Also known as pC4-RHE.
ACCESSION .
VERSION .
KEYWORDS pHet-1
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 5329)
AUTHORS Clontech
TITLE Direct Submission
REFERENCE 2 (bases 1 to 5329)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"
COMMENT Clone into the XbaI site to fuse DmrC to the C-terminus of the
partner protein, or into the SpeI site to fuse DmrC to the
N-terminus of the partner protein.
FEATURES Location/Qualifiers
source 1..5329
/mol_type="other DNA"
/organism="synthetic DNA construct"
enhancer 19..322
/label=CMV enhancer
/note="human cytomegalovirus immediate early enhancer"
promoter 323..526
/label=CMV promoter
/note="human cytomegalovirus (CMV) immediate early
promoter"
5'UTR 616..655
/label=HSV TK 5'-UTR
/note="5' untranslated region from the herpes simplex virus
thymidine kinase gene"
CDS 676..678
/codon_start=1
/product="start codon"
/label=start codon
/note="ATG"
/translation="M"
CDS 688..966
/label=FRB
/note="FKBP-rapamycin binding domain of human FRAP"
CDS 973..999
/label=HA
/note="HA (human influenza hemagglutinin) epitope tag"
intron 1031..1603
/label=beta-globin intron
/note="intron from rabbit beta-globin gene"
polyA_signal 1800..1855
/label=beta-globin poly(A) signal
/note="rabbit beta-globin polyadenylation signal (Gil and
Proudfoot, 1987)"
rep_origin complement(2208..2343)
/direction=LEFT
/label=SV40 ori
/note="SV40 origin of replication"
rep_origin complement(2620..3208)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(3379..4251)
/codon_start=1
/product="beta-lactamase"
/label=beta-lactamase
/note="AmpR"
/note="confers resistance to ampicillin, carbenicillin, and
related antibiotics"
/translation="[TEM beta-lactamase fragment, 45 aa]
ELDLNSGKILESFRPEERFQVEVAMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDL
VEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTR
LDRWEPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPL
LRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAE
IGASLIKHW"
promoter complement(4252..4356)
/label=AmpR promoter
rep_origin complement(4688..5143)
/direction=LEFT
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
primer_bind 5288..5304
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
promoter 5311..5329
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
This page is informational only.