prHom-Nuc1 vector (V011089)

Basic Vector Information

      • Vector Name:
      • prHom-Nuc1
      • Antibiotic Resistance:
      • Ampicillin
      • Length:
      • 6064 bp
      • Type:
      • Mammalian Expression Vectors
      • Replication origin:
      • ori
      • Source/Author:
      • Clontech
      • Copy Number:
      • High copy number
      • Promoter:
      • SV40

prHom-Nuc1 vector Vector Map

prHom-Nuc16064 bp30060090012001500180021002400270030003300360039004200450048005100540057006000CMV enhancerCMV promoter5'UTRATGHASV40 NLSDmrDDmrDDmrDbeta-globin intronbeta-globin poly(A) signalSV40 orioriAmpRAmpR promoterf1 oriM13 fwdT7 promoter

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

prHom-Nuc1 vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       prHom-Nuc1.        6064 bp DNA     circular SYN 01-JAN-1980
DEFINITION  Mammalian vector encoding three FKBP homodimerizer domains, for 
            creating nuclear oligomers that can be dissociated with a drug. Also
            known as pC4EN-FM3.
ACCESSION   .
VERSION     .
KEYWORDS    prHom-Nuc1.
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6064)
  AUTHORS   Clontech
  TITLE     Direct Submission
REFERENCE   2  (bases 1 to 6064)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"
COMMENT     Clone into the XbaI site to target the partner protein to the 
            nucleus and to fuse three copies of DmrD to its C-terminus.
FEATURES             Location/Qualifiers
     source          1..6064
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     enhancer        19..322
                     /label=CMV enhancer
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        323..526
                     /label=CMV promoter
                     /note="human cytomegalovirus (CMV) immediate early
                     promoter"
     5'UTR           616..655
                     /label=HSV TK 5'-UTR
                     /note="5' untranslated region from the herpes simplex virus
                     thymidine kinase gene"
     CDS             673..675
                     /codon_start=1
                     /product="start codon"
                     /label=start codon
                     /note="ATG"
                     /translation="M"
     CDS             685..711
                     /label=HA
                     /note="HA (human influenza hemagglutinin) epitope tag"
     CDS             733..753
                     /label=SV40 NLS
                     /note="nuclear localization signal of SV40 (simian virus
                     40) large T antigen"
     CDS             760..1080
                     /label=DmrD
                     /note="dimeric F36M mutant of FK506-binding protein FKBP12"
     CDS             1087..1407
                     /codon_start=1
                     /product="dimeric F36M mutant of FK506-binding protein
                     FKBP12"
                     /label=dimeric F36M mutant of FK506-binding protein
                     FK
                     /note="DmrD"
                     /note="dimerization can be reversed by ligand binding"
                     /translation="GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKMDSSRDRNKP
                     FKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELL
                     KLE"
     CDS             1414..1734
                     /codon_start=1
                     /product="dimeric F36M mutant of FK506-binding protein
                     FKBP12"
                     /label=dimeric F36M mutant of FK506-binding protein
                     FK
                     /note="DmrD"
                     /note="dimerization can be reversed by ligand binding"
                     /translation="GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKMDSSRDRNKP
                     FKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELL
                     KLE"
     intron          1766..2338
                     /label=beta-globin intron
                     /note="intron from rabbit beta-globin gene"
     polyA_signal    2535..2590
                     /label=beta-globin poly(A) signal
                     /note="rabbit beta-globin polyadenylation signal (Gil and 
                     Proudfoot, 1987)"
     rep_origin      complement(2943..3078)
                     /direction=LEFT
                     /label=SV40 ori
                     /note="SV40 origin of replication"
     rep_origin      complement(3355..3943)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(4114..4986)
                     /codon_start=1
                     /product="beta-lactamase"
                     /label=beta-lactamase
                     /note="AmpR"
                     /note="confers resistance to ampicillin, carbenicillin, and
                     related antibiotics"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
                     ELDLNSGKILESFRPEERFQVEVAMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDL
                     VEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTR
                     LDRWEPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPL
                     LRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAE
                     IGASLIKHW"
     promoter        complement(4987..5091)
                     /label=AmpR promoter
     rep_origin      complement(5423..5878)
                     /direction=LEFT
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     primer_bind     6023..6039
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        6046..6064
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"

This page is informational only.