Basic Vector Information
- Vector Name:
- pLysS
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 4886 bp
- Type:
- pET & Duet Vectors (Novagen)
- Replication origin:
- p15A ori
- Source/Author:
- Novagen (EMD Millipore)
- Copy Number:
- Medium copy number
pLysS vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pLysS vector Sequence
LOCUS 40924_29536 4886 bp DNA circular SYN 01-JAN-1980 DEFINITION Plasmid for expressing low levels of T7 lysozyme, an inhibitor of T7 RNA polymerase. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4886) AUTHORS Novagen (EMD Millipore) TITLE Direct Submission REFERENCE 2 (bases 1 to 4886) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" COMMENT The T7 lysozyme gene is not highly expressed because it is in the antisense orientation relative to the tet promoter. FEATURES Location/Qualifiers source 1..4886 /mol_type="other DNA" /organism="synthetic DNA construct" promoter complement(220..322) /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" rep_origin complement(848..1392) /direction=LEFT /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." promoter 1504..1532 /label=tet promoter /note="E. coli promoter for tetracycline efflux protein gene" promoter complement(1981..2014) /label=T7 Phi-3.8 promoter /note="weak promoter for bacteriophage T7 RNA polymerase" CDS complement(2015..2467) /codon_start=1 /label=T7 lysozyme /note="lysozyme from bacteriophage T7" /translation="MARVQFKQRESTDAIFVHCSATKPSQNVGVREIRQWHKEQGWLDV GYHFIIKRDGTVEAGRDEMAVGSHAKGYNHNSIGVCLVGGIDDKGKFDANFTPAQMQSL RSLLVTLLAKYEGAGLRAHHEVAPKACPSFDLKRWWEKNELVTSDRG" CDS complement(join(4449..4886,1..219)) /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
This page is informational only.