Price Information
| Cat No. | Plasmid Name | Availability | Buy one, get one free! (?) |
|---|---|---|---|
| V010846 | pGreenII 0229 | In stock, instant shipping |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
pGreenII 0229, functioning as a dual-expression vector carrying the target gene and bar selection marker, was introduced into tobacco leaves via Agrobacterium-mediated transformation. Gene expression and function were verified using the GUS reporter gene.
- Vector Name:
- pGreenII 0229
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4446 bp
- Type:
- Plant Vectors
- Replication origin:
- pSa ori
- Source/Author:
- Hellens RP, Edwards EA, Leyland NR, Bean S, Mullineaux PM.
- Copy Number:
- High copy number
- 5' Primer:
- M13 fwd
- 3' Primer:
- M13 rev
- Growth Strain(s):
- Top10
pGreenII 0229 vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
References
- Guo J, Ling H, Ma J, Chen Y, Su Y, Lin Q, Gao S, Wang H, Que Y, Xu L. A sugarcane R2R3-MYB transcription factor gene is alternatively spliced during drought stress. Sci Rep. 2017 Feb 7;7:41922. doi: 10.1038/srep41922. PMID: 28167824; PMCID: PMC5294458.
pGreenII 0229 vector Sequence
LOCUS Exported 4446 bp DNA circular SYN 21-OCT-2025
DEFINITION Agrobacterium binary vector with kanamycin-and
bialophos/phosphinothricin-resistance genes.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 4446)
AUTHORS Hellens RP, Edwards EA, Leyland NR, Bean S, Mullineaux PM.
TITLE pGreen: a versatile and flexible binary Ti vector for
Agrobacterium-mediated plant transformation.
JOURNAL Plant Mol. Biol. 2000;42:819-32.
PUBMED 10890530
REFERENCE 2 (bases 1 to 4446)
AUTHORS pGreen website
TITLE Direct Submission
REFERENCE 3 (bases 1 to 4446)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 4446)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plant Mol.
Biol."; date: "2000"; volume: "42"; pages: "819-32"
COMMENT SGRef: number: 2; type: "Journal Article"
COMMENT SGRef: number: 3; type: "Journal Article"
COMMENT This plasmid must be transformed into an Agrobacterium strain that
also carries a vector such as pSoup.
FEATURES Location/Qualifiers
source 1..4446
/mol_type="other DNA"
/organism="synthetic DNA construct"
rep_origin 63..498
/label=pSa ori
/note="origin of replication from bacterial plasmid pSa"
misc_feature 633..655
/label=LB T-DNA repeat
/note="left border repeat from nopaline C58 T-DNA
(truncated)"
terminator complement(679..930)
/label=NOS terminator
/note="nopaline synthase terminator and poly(A) signal"
CDS complement(953..1501)
/codon_start=1
/label=BlpR
/note="phosphinothricin acetyltransferase"
/translation="MSPERRPADIRRATEADMPAVCTIVNHYIQTSTVNFRTEPQEPQE
WTDDLVRLRERYPWLVAEVDGEVAGIAYAGPWKARNAYDWTAESTVYVSPRHQRTGLGS
TLYTHLLKSLEAQGFKSVVAVIGLPNDPSVRMHEALGYAPRGMLRAAGFKHGNWHDVGF
WQLDFSLPVPPRPVLPVTEI"
promoter complement(1544..1721)
/label=NOS promoter
/note="nopaline synthase promoter"
primer_bind 1968..1984
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
promoter 1991..2009
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
misc_feature complement(2018..2124)
/label=MCS
/note="pBluescript multiple cloning site"
promoter complement(2137..2155)
/label=T3 promoter
/note="promoter for bacteriophage T3 RNA polymerase"
primer_bind complement(2176..2192)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(2200..2216)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(2224..2254)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(2269..2290)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
misc_feature 2529..2553
/label=RB T-DNA repeat
/note="right border repeat from nopaline C58 T-DNA"
rep_origin complement(2644..3232)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(3406..4218)
/codon_start=1
/label=KanR
/note="aminoglycoside phosphotransferase"
/translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG
KPDAPELFLKHGKGSVANVVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK
TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA
SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI
ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"