Basic Vector Information
- Vector Name:
- pLVX-Het-Mem1
- Antibiotic Resistance:
- Ampicillin
- Length:
- 9268 bp
- Type:
- Viral Expression & Packaging Vectors
- Replication origin:
- ori
- Source/Author:
- Clontech
- Copy Number:
- High copy number
- Promoter:
- CMV
pLVX-Het-Mem1 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pLVX-Het-Mem1 vector Sequence
LOCUS pLVX-Het-Mem1. 9268 bp DNA circular SYN 01-JAN-1980
DEFINITION Lentiviral vector encoding FKBP heterodimerizer domains, for
creating membrane-associated fusion proteins that can be dimerized
with a drug.
ACCESSION .
VERSION .
KEYWORDS pLVX-Het-Mem1.
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 9268)
AUTHORS Clontech
TITLE Direct Submission
REFERENCE 2 (bases 1 to 9268)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"
COMMENT The N-myristoylation signal must be at the N-terminus of the fusion
protein.
FEATURES Location/Qualifiers
source 1..9268
/mol_type="other DNA"
/organism="synthetic DNA construct"
LTR 1..634
/label=3' LTR
/note="3' long terminal repeat (LTR) from HIV-1"
misc_feature 681..806
/label=HIV-1 Psi
/note="packaging signal of human immunodeficiency virus
type 1"
misc_feature 1303..1536
/label=RRE
/note="The Rev response element (RRE) of HIV-1 allows for
Rev-dependent mRNA export from the nucleus to the
cytoplasm."
CDS 1721..1765
/label=gp41 peptide
/note="antigenic peptide corresponding to amino acids 655
to 669 of the HIV envelope protein gp41 (Lutje Hulsik et
al., 2013)"
CDS 1914..1955
/note="Protein Tat from Human immunodeficiency virus type 1
group M subtype B (isolate WMJ22). Accession#: P12509"
misc_feature 2027..2144
/label=cPPT/CTS
/note="central polypurine tract and central termination
sequence of HIV-1"
enhancer 2201..2504
/label=CMV enhancer
/note="human cytomegalovirus immediate early enhancer"
promoter 2505..2708
/label=CMV promoter
/note="human cytomegalovirus (CMV) immediate early
promoter"
misc_feature 2810..2821
/label=5' MCS
/note="5' MCS"
/note="multiple cloning site upstream of DmrA"
CDS 2822..2863
/label=myr
/note="N-myristoylation signal from Src kinase (Pellman et
al., 1985; Kaplan et al., 1988)"
CDS 2870..3190
/label=FKBP
/note="human FK506-binding protein FKBP12"
CDS 3197..3517
/codon_start=1
/product="human FK506-binding protein FKBP12"
/label=human FK506-binding protein FKBP12
/note="FKBP (DmrA)"
/note="synthetic gene with alternative codons"
/translation="GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKP
FKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELL
KLE"
misc_feature 3519..3532
/label=3' MCS
/note="3' MCS"
/note="multiple cloning site downstream of DmrA"
misc_feature 3545..4131
/label=IRES2
/note="internal ribosome entry site (IRES) of the
encephalomyocarditis virus (EMCV)"
CDS 4157..5173
/label=HygR
/note="aminoglycoside phosphotransferase from E. coli"
misc_feature 5190..5778
/label=WPRE
/note="woodchuck hepatitis virus posttranscriptional
regulatory element"
LTR 5986..6619
/label=5' LTR
/note="5' long terminal repeat (LTR) from HIV-1"
primer_bind complement(6748..6764)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(6772..6788)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(6796..6826)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(6841..6862)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(7150..7735)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(7909..8766)
/label=AmpR
/note="beta-lactamase"
promoter complement(8767..8871)
/label=AmpR promoter
polyA_signal 8919..9053
/label=SV40 poly(A) signal
/note="SV40 polyadenylation signal"
This page is informational only.