Basic Vector Information
- Vector Name:
- pLVX-Hom-Mem1
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8841 bp
- Type:
- Viral Expression & Packaging Vectors
- Replication origin:
- ori
- Source/Author:
- Clontech
- Copy Number:
- High copy number
- Promoter:
- CMV
pLVX-Hom-Mem1 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pLVX-Hom-Mem1 vector Sequence
LOCUS pLVX-Hom-Mem1. 8841 bp DNA circular SYN 01-JAN-1980 DEFINITION Lentiviral vector encoding FKBP homodimerizer domains, for creating membrane-associated fusion proteins that can be dimerized with a drug. ACCESSION . VERSION . KEYWORDS pLVX-Hom-Mem1. SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8841) AUTHORS Clontech TITLE Direct Submission REFERENCE 2 (bases 1 to 8841) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" COMMENT The N-myristoylation signal must be at the N-terminus of the fusion protein. FEATURES Location/Qualifiers source 1..8841 /mol_type="other DNA" /organism="synthetic DNA construct" LTR 1..634 /label=3' LTR /note="3' long terminal repeat (LTR) from HIV-1" misc_feature 681..806 /label=HIV-1 Psi /note="packaging signal of human immunodeficiency virus type 1" misc_feature 1303..1536 /label=RRE /note="The Rev response element (RRE) of HIV-1 allows for Rev-dependent mRNA export from the nucleus to the cytoplasm." CDS 1721..1765 /label=gp41 peptide /note="antigenic peptide corresponding to amino acids 655 to 669 of the HIV envelope protein gp41 (Lutje Hulsik et al., 2013)" CDS 1914..1955 /note="Protein Tat from Human immunodeficiency virus type 1 group M subtype B (isolate WMJ22). Accession#: P12509" misc_feature 2027..2144 /label=cPPT/CTS /note="central polypurine tract and central termination sequence of HIV-1" enhancer 2201..2504 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 2505..2708 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" misc_feature 2803..2820 /label=5' MCS /note="5' MCS" /note="multiple cloning site upstream of DmrB" CDS 2821..2862 /label=myr /note="N-myristoylation signal from Src kinase (Pellman et al., 1985; Kaplan et al., 1988)" CDS 2869..3189 /label=DmrB /note="F36V mutant of FK506-binding protein FKBP12" CDS 3196..3516 /codon_start=1 /product="F36V mutant of FK506-binding protein FKBP12" /label=F36V mutant of FK506-binding protein FKBP12 /note="DmrB" /note="binds synthetic ligands that do not bind wild-type FKBP" /translation="GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKVDSSRDRNKP FKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELL KLE" misc_feature 3518..3531 /label=3' MCS /note="3' MCS" /note="multiple cloning site downstream of DmrB" misc_feature 3544..4130 /label=IRES2 /note="internal ribosome entry site (IRES) of the encephalomyocarditis virus (EMCV)" CDS 4150..4746 /label=PuroR /note="puromycin N-acetyltransferase" misc_feature 4763..5351 /label=WPRE /note="woodchuck hepatitis virus posttranscriptional regulatory element" LTR 5559..6192 /label=5' LTR /note="5' long terminal repeat (LTR) from HIV-1" primer_bind complement(6321..6337) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(6345..6361) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(6369..6399) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(6414..6435) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(6723..7308) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(7482..8339) /label=AmpR /note="beta-lactamase" promoter complement(8340..8444) /label=AmpR promoter polyA_signal 8492..8626 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal"
This page is informational only.