Basic Vector Information
- Vector Name:
- pLVX-rHom-Sec1
- Antibiotic Resistance:
- Ampicillin
- Length:
- 9550 bp
- Type:
- Viral Expression & Packaging Vectors
- Replication origin:
- ori
- Source/Author:
- Clontech
- Copy Number:
- High copy number
- Promoter:
- CMV
pLVX-rHom-Sec1 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pLVX-rHom-Sec1 vector Sequence
LOCUS pLVX-rHom-Sec1. 9550 bp DNA circular SYN 01-JAN-1980 DEFINITION Lentiviral vector encoding four FKBP homodimerizer domains, for creating ER-localized oligomers that can be dissociated with a drug. ACCESSION . VERSION . KEYWORDS pLVX-rHom-Sec1. SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 9550) AUTHORS Clontech TITLE Direct Submission REFERENCE 2 (bases 1 to 9550) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" FEATURES Location/Qualifiers source 1..9550 /mol_type="other DNA" /organism="synthetic DNA construct" LTR 1..634 /label=3' LTR /note="3' long terminal repeat (LTR) from HIV-1" misc_feature 681..806 /label=HIV-1 Psi /note="packaging signal of human immunodeficiency virus type 1" misc_feature 1303..1536 /label=RRE /note="The Rev response element (RRE) of HIV-1 allows for Rev-dependent mRNA export from the nucleus to the cytoplasm." CDS 1721..1765 /label=gp41 peptide /note="antigenic peptide corresponding to amino acids 655 to 669 of the HIV envelope protein gp41 (Lutje Hulsik et al., 2013)" CDS 1914..1955 /note="Protein Tat from Human immunodeficiency virus type 1 group M subtype B (isolate WMJ22). Accession#: P12509" misc_feature 2027..2144 /label=cPPT/CTS /note="central polypurine tract and central termination sequence of HIV-1" enhancer 2201..2504 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 2505..2708 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" misc_feature 2804..2815 /label=5' MCS /note="5' MCS" /note="multiple cloning site upstream of DmrD" sig_peptide 2822..2899 /label=hGH signal sequence /note="human growth hormone signal sequence" CDS 2906..3226 /label=DmrD /note="dimeric F36M mutant of FK506-binding protein FKBP12" CDS 3233..3553 /codon_start=1 /product="dimeric F36M mutant of FK506-binding protein FKBP12" /label=dimeric F36M mutant of FK506-binding protein FK /note="DmrD" /note="dimerization can be reversed by ligand binding" /translation="GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKMDSSRDRNKP FKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELL KLE" CDS 3560..3880 /codon_start=1 /product="dimeric F36M mutant of FK506-binding protein FKBP12" /label=dimeric F36M mutant of FK506-binding protein FK /note="DmrD" /note="dimerization can be reversed by ligand binding" /translation="GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKMDSSRDRNKP FKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELL KLE" CDS 3887..4207 /codon_start=1 /product="dimeric F36M mutant of FK506-binding protein FKBP12" /label=dimeric F36M mutant of FK506-binding protein FK /note="DmrD" /note="dimerization can be reversed by ligand binding" /translation="GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKMDSSRDRNKP FKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELL KLE" misc_feature 4227..4240 /label=3' MCS /note="3' MCS" /note="multiple cloning site downstream of DmrD" misc_feature 4253..4839 /label=IRES2 /note="internal ribosome entry site (IRES) of the encephalomyocarditis virus (EMCV)" CDS 4859..5455 /label=PuroR /note="puromycin N-acetyltransferase" misc_feature 5472..6060 /label=WPRE /note="woodchuck hepatitis virus posttranscriptional regulatory element" LTR 6268..6901 /label=5' LTR /note="5' long terminal repeat (LTR) from HIV-1" primer_bind complement(7030..7046) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(7054..7070) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(7078..7108) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(7123..7144) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(7432..8017) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(8191..9048) /label=AmpR /note="beta-lactamase" promoter complement(9049..9153) /label=AmpR promoter polyA_signal 9201..9335 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal"
This page is informational only.