Cart 2

ptTS-Neo vector (V010350#)

Basic Vector Information

Basic Vector Information
Vector Name ptTS-Neo Antibiotic Resistance Ampicillin
Length 6365 bp Type Viral Expression & Packaging Vectors
Source Clontech Selection Marker Neomycin/G418(Geneticin)
Copy Number High copy number

ptTS-Neo vector Vector Map

SV40 promoter NeoR/KanR HSV TK poly(A) signal CMV enhancer CMV promoter tTS beta-globin intron beta-globin poly(A) signal ori bla bla

ptTS-Neo vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported                6365 bp ds-DNA    circular SYN 10-1-2013
DEFINITION  Vector for expressing tTS, which represses expression from 
            Tet-responsive promoters in the absence of doxycycline.
ACCESSION   .
VERSION     .
KEYWORDS    ptTS-Neo
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6365)
  AUTHORS   Clontech
  TITLE     Direct Submission
COMMENT     
FEATURES             Location/Qualifiers
     source          1..6365
                     /organism="synthetic DNA construct"
                     /lab_host="Mammalian Cells"
                     /mol_type="other DNA"
     promoter        58..254
                     /note="SV40 promoter"
                     /note="SV40 early promoter"
     rep_origin      105..240
                     /note="SV40 ori"
                     /note="SV40 origin of replication"
     CDS             289..1083
                     /codon_start=1
                     /gene="aph(3')-II (or nptII)"
                     /product="aminoglycoside phosphotransferase from Tn5"
                     /note="NeoR/KanR"
                     /note="confers resistance to neomycin, kanamycin, and G418 
                     (Geneticin)"
                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ
                     GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
     polyA_signal    1315..1363
                     /note="HSV TK poly(A) signal"
                     /note="herpesvirus thymidine kinase polyadenylation signal"
     enhancer        1449..1828
                     /note="CMV enhancer"
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        1829..2032
                     /note="CMV promoter"
                     /note="human cytomegalovirus (CMV) immediate early 
                     promoter"
     CDS             2135..2983
                     /codon_start=1
                     /product="fusion of a hybrid tetracycline repressor TetR 
                     with a nuclear localization signal and a KRAB silencing 
                     domain"
                     /note="tTS"
                     /note="silences Tet-responsive promoters in the absence but
                     not the presence of doxycycline"
                     /translation="MSRLDKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHV
                     RNKQTLMNMLSEAILAKHHTRSAPLPTESWQQFLQENALSFRKALLVHRDGARLHIGTS
                     PTPPQFEQAEAQLRCLCDAGFSVEEALFILQSISHFTLGAVLEEQATNQIENNHVIDAA
                     PPLLQEAFNIQARTSAEMAFHFGLKSLIFGFSAQLDEKKHTPIEDGNKPKKKRKLAVSV
                     TFEDVAVLFTRDEWKKLDLSQRSLYREVMLENYSNLASMAGFLFTKPKVISLLQQGEDP
                     W"
     intron          3004..3576
                     /note="beta-globin intron"
                     /note="intron from rabbit beta-globin gene"
     polyA_site      3773..3828
                     /note="beta-globin poly(A) signal"
                     /note="rabbit beta-globin polyadenylation signal"
     rep_origin      complement(4546..5134)
                     /direction=LEFT
                     /note="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(5305..6165)
                     /codon_start=1
                     /gene="bla"
                     /product="beta-lactamase"
                     /note="AmpR"
                     /note="confers resistance to ampicillin, carbenicillin, and
                     related antibiotics"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
                     LIKHW"
     promoter        complement(6166..6270)
                     /gene="bla"
                     /note="AmpR promoter"

This page is informational only.