Basic Vector Information
- Vector Name:
- pPIC6 B
- Antibiotic Resistance:
- Blasticidin
- Length:
- 3380 bp
- Type:
- Yeast Plasmids
- Replication origin:
- ori
- Source/Author:
- Invitrogen (Life Technologies)
- Copy Number:
- High copy number
- Promoter:
- AOX1
pPIC6 B vector Map
pPIC6 B vector Sequence
LOCUS 40924_34515 3380 bp DNA circular SYN 13-SEP-2021
DEFINITION synthetic circular DNA.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 3380)
TITLE Direct Submission
REFERENCE 2 (bases 1 to 3380)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..3380
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 2..940
/label=AOX1 promoter
/note="inducible promoter, regulated by methanol"
CDS 1010..1039
/codon_start=1
/label=Myc
/note="Myc (human c-Myc proto-oncogene) epitope tag"
/translation="EQKLISEEDL"
CDS 1055..1072
/codon_start=1
/label=6xHis
/note="6xHis affinity tag"
/translation="HHHHHH"
terminator 1152..1398
/label=AOX1 terminator
/note="transcription terminator for AOX1"
promoter 1413..1824
/label=TEF1 promoter
/note="promoter for EF-1-alpha"
promoter 1832..1879
/label=EM7 promoter
/note="synthetic bacterial promoter"
CDS 1898..2293
/codon_start=1
/label=BSD
/note="blasticidin S deaminase"
/translation="MAKPLSQEESTLIERATATINSIPISEDYSVASAALSSDGRIFTG
VNVYHFTGGPCAELVVLGTAAAAAAGNLTCIVAIGNENRGILSPCGRCRQVLLDLHPGI
KAIVKDSDGQPTAVGIRELLPSGYVWEG"
terminator 2390..2637
/label=CYC1 terminator
/note="transcription terminator for CYC1"
rep_origin complement(2712..3300)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
This page is informational only.