pPICZ A vector (V010244)

Basic Vector Information

      • Vector Name:
      • pPICZ A
      • Antibiotic Resistance:
      • Bleomycin
      • Length:
      • 3329 bp
      • Type:
      • Yeast Plasmids
      • Source/Author:
      • Invitrogen (Life Technologies)
      • Copy Number:
      • High copy number

pPICZ A vector Vector Map

pPICZ A3329 bp6001200180024003000AOX1 promoterMyc6xHisAOX1 terminatorTEF1 promoterEM7 promoterBleoRCYC1 terminatorori

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

pPICZ A vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       40924_34570        3329 bp DNA     circular SYN 13-SEP-2021
DEFINITION  synthetic circular DNA.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3329)
  TITLE     Direct Submission
REFERENCE   2  (bases 1 to 3329)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..3329
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        2..940
                     /label=AOX1 promoter
                     /note="inducible promoter, regulated by methanol"
     CDS             1012..1041
                     /codon_start=1
                     /label=Myc
                     /note="Myc (human c-Myc proto-oncogene) epitope tag"
                     /translation="EQKLISEEDL"
     CDS             1057..1074
                     /codon_start=1
                     /label=6xHis
                     /note="6xHis affinity tag"
                     /translation="HHHHHH"
     terminator      1153..1399
                     /label=AOX1 terminator
                     /note="transcription terminator for AOX1"
     promoter        1414..1825
                     /label=TEF1 promoter
                     /note="promoter for EF-1-alpha"
     promoter        1833..1880
                     /label=EM7 promoter
                     /note="synthetic bacterial promoter"
     CDS             1899..2270
                     /codon_start=1
                     /label=BleoR
                     /note="antibiotic-binding protein"
                     /translation="MAKLTSAVPVLTARDVAGAVEFWTDRLGFSRDFVEDDFAGVVRDD
                     VTLFISAVQDQVVPDNTLAWVWVRGLDELYAEWSEVVSTNFRDASGPAMTEIGEQPWGR
                     EFALRDPAGNCVHFVAEEQD"
     terminator      2339..2586
                     /label=CYC1 terminator
                     /note="transcription terminator for CYC1"
     rep_origin      complement(2661..3249)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"

This page is informational only.