Basic Vector Information
- Vector Name:
- YCp50-poly
- Antibiotic Resistance:
- Ampicillin
- Length:
- 7060 bp
- Type:
- Yeast Plasmids
- Replication origin:
- ori
- Host:
- Yeast
- Copy Number:
- High copy number
- Promoter:
- URA3
- 3' Primer:
- M13 rev
YCp50-poly vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
YCp50-poly vector Sequence
LOCUS 40924_49442 7060 bp DNA circular SYN 01-JAN-1980 DEFINITION Derivative of yeast centromeric vector YCp50 containing the pUC19 polylinker. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7060) TITLE Direct Submission REFERENCE 2 (bases 1 to 7060) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" COMMENT YCp50-poly was constructed in two steps: (1) YCp50 was cleaved with XhoI and Asp718, blunted and ligated. (2) This construct was then cleaved with EcoRI and SalI, and the EcoRI-PvuII fragment of pUC19 was inserted. FEATURES Location/Qualifiers source 1..7060 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 1..57 /label=MCS /note="pUC18/19 multiple cloning site" primer_bind complement(70..86) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(94..110) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(118..148) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(163..184) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 1021..1241 /label=URA3 promoter CDS 1242..2042 /codon_start=1 /label=URA3 /note="orotidine-5'-phosphate decarboxylase, required for uracil biosynthesis" /translation="MSKATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELL ELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFEDRKFADIGNTVKLQ YSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLSTGE YTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDD VVSTGSDIIIVGRGLFAKGRDAKVEGERYRKAGWEAYLRRCGQQN" misc_feature complement(3390..3682) /label=CEN4 /note="S. cerevisiae CEN4 centromere" rep_origin complement(4315..4768) /direction=LEFT /label=ARS1 /note="S. cerevisiae autonomously replicating sequence ARS1" misc_feature 4910..5050 /label=bom /note="basis of mobility region from pBR322" rep_origin complement(5236..5824) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(5998..6855) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" promoter complement(6856..6960) /label=AmpR promoter
This page is informational only.