Basic Vector Information
- Vector Name:
- YRp7
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5817 bp
- Type:
- Yeast Plasmids
- Replication origin:
- ori
- Source/Author:
- Struhl K, Stinchcomb DT, Scherer S, Davis RW.
- Copy Number:
- High copy number
- Promoter:
- TRP1
YRp7 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
YRp7 vector Sequence
LOCUS 40924_49792 5817 bp DNA circular SYN 17-DEC-2018 DEFINITION Yeast replicating vector YRp7, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5817) AUTHORS Struhl K, Stinchcomb DT, Scherer S, Davis RW. TITLE High-frequency transformation of yeast: autonomous replication of hybrid DNA molecules JOURNAL Proc. Natl. Acad. Sci. U.S.A. 76 (3), 1035-1039 (1979) PUBMED 375221 REFERENCE 2 (bases 1 to 5817) AUTHORS Stillman DJ. TITLE Direct Submission JOURNAL Submitted (16-NOV-1993) David J. Stillman, Dept. of Cellular, Viral and Molecular Biology, University of Utah Medical Center, Salt Lake City, UT 84132 USA REFERENCE 3 (bases 1 to 5817) TITLE Direct Submission REFERENCE 4 (bases 1 to 5817) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Proc. Natl. Acad. Sci. U.S.A."; date: "1979"; volume: "76"; issue: "3"; pages: "1035-1039" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (16-NOV-1993) David J. Stillman, Dept. of Cellular, Viral and Molecular Biology, University of Utah Medical Center, Salt Lake City, UT 84132 USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5817 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin complement(7..844) /direction=LEFT /label=ARS1 /note="S. cerevisiae autonomously replicating sequence ARS1/ARS416" promoter complement(1358..1459) /label=TRP1 promoter promoter 1467..1495 /label=tet promoter /note="E. coli promoter for tetracycline efflux protein gene" CDS 1543..2730 /codon_start=1 /label=TcR /note="tetracycline efflux protein" /translation="MKSNNALIVILGTVTLDAVGIGLVMPVLPGLLRDIVHSDSIASHY GVLLALYALMQFLCAPVLGALSDRFGRRPVLLASLLGATIDYAIMATTPVLWILYAGRI VAGITGATGAVAGAYIADITDGEDRARHFGLMSACFGVGMVAGPVAGGLLGAISLHAPF LAAAVLNGLNLLLGCFLMQESHKGERRPMPLRAFNPVSSFRWARGMTIVAALMTVFFIM QLVGQVPAALWVIFGEDRFRWSATMIGLSLAVFGILHALAQAFVTGPATKRFGEKQAII AGMAADALGYVLLAFATRGWMAFPIMILLASGGIGMPALQAMLSRQVDDDHQGQLQGSL AALTSLTSITGPLIVTAIYAASASTWNGLAWIVGAALYLVCLPALRRGAWSRATST" CDS 3374..3562 /codon_start=1 /label=rop /note="Rop protein, which maintains plasmids at low copy number" /translation="VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA DELYRSCLARFGDDGENL" misc_feature 3667..3807 /label=bom /note="basis of mobility region from pBR322" rep_origin complement(3993..4581) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(4755..5612) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" promoter complement(5613..5717) /label=AmpR promoter
This page is informational only.