Price Information
| Cat No. | Plasmid Name | Availability | Add to cart |
|---|---|---|---|
| V010158 | pSecTag2A-E06-scFv | In stock (lyophilized plasmid) |
Buy one, get one free! |
Two vials of lyophilized plasmid will be delivered, each vial is about 5µg.
Basic Vector Information
The E06 antibody is a murine monoclonal IgM natural antibody that binds to oxidized phospholipid and reacts with oxidized LDL, oxidized HDL and protein covalently modified by oxidized phospholipid. This antibody has been used to probe atherosclerotic plaque in mice, zebrafish, rabbits, monkeys and humans. It also binds to apoptotic cells, but not viable cells, and can be used in a variety of applications, including ELISA, immunohistochemistry and Western blot analysis, as well as for in vivo imaging with MRI techniques.
- Vector Name:
- pSecTag2A-E06-scFv
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5846 bp
- Type:
- Mammalian Expression Vectors
- Replication origin:
- ori
- Source/Author:
- Dr. Joseph Witztum
- Selection Marker:
- Zeocin
- Copy Number:
- High copy number
- Promoter:
- CMV
- Cloning Method:
- Enzyme Cut
- 5' Primer:
- T7 promoter
- 3' Primer:
- BGH Reverse primer
- Fusion Tag:
- Myc,6*His
- Growth Strain(s):
- JM108
- Growth Temperature:
- 37℃
pSecTag2A-E06-scFv vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
References
- Que X, Hung MY, Yeang C, Gonen A, Prohaska TA, Sun X, Diehl C, Määttä A, Gaddis DE, Bowden K, Pattison J, MacDonald JG, Ylä-Herttuala S, Mellon PL, Hedrick CC, Ley K, Miller YI, Glass CK, Peterson KL, Binder CJ, Tsimikas S, Witztum JL. Oxidized phospholipids are proinflammatory and proatherogenic in hypercholesterolaemic mice. Nature. 2018 Jun;558(7709):301-306.
pSecTag2A-E06-scFv vector Sequence
LOCUS pSecTag2A-E06-sc 5846 bp DNA circular SYN 11-JUN-2018
DEFINITION synthetic circular DNA.
ACCESSION .
VERSION .
KEYWORDS pSecTag2A-E06-scFv.
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 5846)
AUTHORS Triple Threat
TITLE Direct Submission
REFERENCE 2 (bases 1 to 5846)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..5846
/mol_type="other DNA"
/organism="synthetic DNA construct"
enhancer 235..614
/label=CMV enhancer
/note="human cytomegalovirus immediate early enhancer"
promoter 615..818
/label=CMV promoter
/note="human cytomegalovirus (CMV) immediate early
promoter"
promoter 863..881
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
sig_peptide 905..967
/label=Ig-kappa leader
/note="leader sequence from mouse immunoglobulin kappa
light
chain"
CDS 968..1342
/codon_start=1
/label=E06 VL
/note="E06 VL"
/translation="AAQPARRAVRSLDIVMTQSPSSLSVSAGKKVTISCTASESLYSSK
HKVHYLAWYQKKPEQSPKLLIYGASNRYIGVPDRFTGSGSGTDFTLTISSVQVEDLTHY
YCAQFYSYPLTFGAGTKLEIK"
CDS 1343..1387
/codon_start=1
/label=G4S x 3
/note="G4S x 3"
/translation="GGGGSGGGGSGGGGS"
CDS 1388..1768
/codon_start=1
/label=E06 VH
/note="E06 VH"
/translation="EVKLVESGGGLVQPGGSLRLSCATSGFTFSDFYMEWVRQAPGKRL
EWIAASRNKANDYTTEYADSVKGRFIVSRDTSQSILYLQMNALRAEDTAIYYCARDYYG
SSYWYFDVWGAGTTVTVSSRGGP"
CDS 1769..1798
/codon_start=1
/product="Myc (human c-Myc oncogene) epitope tag"
/label=Myc
/note="Myc"
/translation="EQKLISEEDL"
CDS 1814..1831
/label=6xHis
/note="6xHis affinity tag"
polyA_signal 1860..2084
/label=bGH poly(A) signal
/note="bovine growth hormone polyadenylation signal"
rep_origin 2130..2558
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
promoter 2572..2901
/label=SV40 promoter
/note="SV40 enhancer and early promoter"
promoter 2949..2996
/label=EM7 promoter
/note="synthetic bacterial promoter"
CDS 3015..3386
/label=BleoR
/note="antibiotic-binding protein"
polyA_signal 3519..3652
/label=SV40 poly(A) signal
/note="SV40 polyadenylation signal"
primer_bind complement(3689..3705)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(3713..3729)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(3737..3767)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(3782..3803)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(4091..4679)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(4853..5710)
/label=AmpR
/note="beta-lactamase"
promoter complement(5711..5815)
/label=AmpR promoter