pSecTag2A-E06-scFv vector (Cat. No.: V010158)

pSecTag2A-E06-scFv5846 bp60012001800240030003600420048005400CMV enhancerCMV promoterT7 promoterIg-kappa leaderE06 VLG4S x 3E06 VHMyc6xHisbGH poly(A) signalf1 oriSV40 promoterEM7 promoterBleoRSV40 poly(A) signalM13 revlac operatorlac promoterCAP binding siteoriAmpRAmpR promoter
Basic Information

Note: The E06 antibody is a murine monoclonal IgM natural antibody that binds to oxidized phospholipid and reacts with oxidized LDL, oxidized HDL and protein covalently modified by oxidized phospholipid. This antibody has been used to probe atherosclerotic plaque in mice, zebrafish, rabbits, monkeys and humans. It also binds to apoptotic cells, but not viable cells, and can be used in a variety of applications, including ELISA, immunohistochemistry and Western blot analysis, as well as for in vivo imaging with MRI techniques.

Name:
pSecTag2A-E06-scFv
Antibiotic Resistance:
Ampicillin
Length:
5846 bp
Type:
Mammalian Expression Vectors
Replication origin:
ori
Source/Author:
Dr. Joseph Witztum
Selection Marker:
Zeocin
Copy Number:
High copy number
Promoter:
CMV
Cloning Method:
Enzyme Cut
5' Primer:
T7 promoter
3' Primer:
BGH Reverse primer
Fusion Tag:
Myc,6*His
Growth Strain(s):
JM108
Growth Temperature:
37℃
$ 298.5
In stock, instant shipping
Buy one, get one free! (?)
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.

Plasmid Protocol

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5. Store the plasmid at -20 ℃.

6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it

General Plasmid Transform Protocol

1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.

2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.

3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.

4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.

5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.

References

  • Que X, Hung MY, Yeang C, Gonen A, Prohaska TA, Sun X, Diehl C, Määttä A, Gaddis DE, Bowden K, Pattison J, MacDonald JG, Ylä-Herttuala S, Mellon PL, Hedrick CC, Ley K, Miller YI, Glass CK, Peterson KL, Binder CJ, Tsimikas S, Witztum JL. Oxidized phospholipids are proinflammatory and proatherogenic in hypercholesterolaemic mice. Nature. 2018 Jun;558(7709):301-306.

pSecTag2A-E06-scFv vector (Cat. No.: V010158) Sequence

LOCUS       Exported                5846 bp DNA     circular SYN 02-SEP-2024
DEFINITION  synthetic circular DNA.
ACCESSION   .
VERSION     .
KEYWORDS    pSecTag2A-E06-scFv
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5846)
  AUTHORS   Triple Threat
  TITLE     Direct Submission
REFERENCE   2  (bases 1 to 5846)
  TITLE     Direct Submission
REFERENCE   3  (bases 1 to 5846)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"
COMMENT     SGRef: number: 2; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..5846
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     enhancer        235..614
                     /label=CMV enhancer
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        615..818
                     /label=CMV promoter
                     /note="human cytomegalovirus (CMV) immediate early
                     promoter"
     promoter        863..881
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     sig_peptide     905..967
                     /label=Ig-kappa leader
                     /note="leader sequence from mouse immunoglobulin kappa
                     light
                     chain"
     CDS             968..1342
                     /codon_start=1
                     /label=E06 VL
                     /note="E06 VL"
                     /translation="AAQPARRAVRSLDIVMTQSPSSLSVSAGKKVTISCTASESLYSSK
                     HKVHYLAWYQKKPEQSPKLLIYGASNRYIGVPDRFTGSGSGTDFTLTISSVQVEDLTHY
                     YCAQFYSYPLTFGAGTKLEIK"
     CDS             1343..1387
                     /codon_start=1
                     /label=G4S x 3
                     /note="G4S x 3"
                     /translation="GGGGSGGGGSGGGGS"
     CDS             1388..1768
                     /codon_start=1
                     /label=E06 VH
                     /note="E06 VH"
                     /translation="EVKLVESGGGLVQPGGSLRLSCATSGFTFSDFYMEWVRQAPGKRL
                     EWIAASRNKANDYTTEYADSVKGRFIVSRDTSQSILYLQMNALRAEDTAIYYCARDYYG
                     SSYWYFDVWGAGTTVTVSSRGGP"
     CDS             1769..1798
                     /codon_start=1
                     /product="Myc (human c-Myc oncogene) epitope tag"
                     /label=Myc
                     /note="Myc"
                     /translation="EQKLISEEDL"
     CDS             1814..1831
                     /label=6xHis
                     /note="6xHis affinity tag"
     polyA_signal    1860..2084
                     /label=bGH poly(A) signal
                     /note="bovine growth hormone polyadenylation signal"
     rep_origin      2130..2558
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     promoter        2572..2901
                     /label=SV40 promoter
                     /note="SV40 enhancer and early promoter"
     promoter        2949..2996
                     /label=EM7 promoter
                     /note="synthetic bacterial promoter"
     CDS             3015..3386
                     /label=BleoR
                     /note="antibiotic-binding protein"
     polyA_signal    3519..3652
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     primer_bind     complement(3689..3705)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    complement(3713..3729)
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(3737..3767)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(3782..3803)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      complement(4091..4679)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(4853..5710)
                     /label=AmpR
                     /note="beta-lactamase"
     promoter        complement(5711..5815)
                     /label=AmpR promoter