TLQP-62 peptide

TLQP-62 peptide

• COA/MS/HPLC Report
• Handling and Storage of Synthetic Peptides
• Material Safety Data Sheets (MSDS)

Batch to batch variation of the purity

TLQPPASSRRRHFHHALPPARHHPDLEAQARRAQEEADAEERRLQEQEELENYIEHVLLHRP

Thr-Leu-Gln-Pro-Pro-Ala-Ser-Ser-Arg-Arg-Arg-His-Phe-His-His-Ala-Leu-Pro-Pro-Ala-Arg-His-His-Pro-Asp-Leu-Glu-Ala-Gln-Ala-Arg-Arg-Ala-Gln-Glu-Glu-Ala-Asp-Ala-Glu-Glu-Arg-Arg-Leu-Gln-Glu-Gln-Glu-Glu-Leu-Glu-Asn-Tyr-Ile-Glu-His-Val-Leu-Leu-His-Arg-Pro

62

98.59%

C₃₁₈H₄₉₉N₁₀₉O₉₇

7401.01

Synthetic

Powder

The source of TLQP-62 is Rattus norvegicus. TLQP-62 belongs to VGF. TLQP-62 is expressed in Central and peripheral nervous systems, synthesized exclusively in neuronal and neuroendocrine cells.
The C-terminal peptide TLQP-62 is of particular relevance to maladaptive mechanisms of chronic pain as it is a known mediator of neuroplasticity in the hippocampus affecting learning, memory, depression, and adult neurogenesis.

Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides

• Moss A, Ingram R, Koch S, Theodorou A, Low L, Baccei M, et al. Origins, actions and dynamic expression patterns of the neuropeptide VGF in rat peripheral and central sensory neurones following peripheral nerve injury. Mol Pain. 2008
• Skorput AGJ, Zhang X, Waataja JJ, Peterson CD, Riedl MS, Kitto KF, Truong H, Huffman C, Salton SR, Fairbanks CA, Honda CN, Vulchanova L. Involvement of the VGF-derived peptide TLQP-62 in nerve injury-induced hypersensitivity and spinal neuroplasticity. Pain. 2018 Sep;159(9):1802-1813. doi: 10.1097/j.pain.0000000000001277.

Trifluoroacetic acid (TFA) is a common counterion from the purification process using High-Performance Liquid Chromatography (HPLC). The presence of TFA can affect the peptide's net weight, appearance, and solubility.

Impact on Net Weight: The TFA salt contributes to the total mass of the product. In most cases, the peptide content constitutes >80% of the total weight, with TFA accounting for the remainder.

Solubility: TFA salts generally enhance the solubility of peptides in aqueous solutions.

In Biological Assays: For most standard in vitro assays, the residual TFA levels do not cause interference. However, for highly sensitive cellular or biochemical studies, please be aware of its presence.