Urodilatin (URO), Thr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine) peptide

Urodilatin (URO), Thr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine) peptide

• COA/MS/HPLC Report
• Handling and Storage of Synthetic Peptides
• Material Safety Data Sheets (MSDS)

Batch to batch variation of the purity

TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY(C11-C27 disulfide bond)

H-Thr-Ala-Pro-Arg-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr-OH (C11-C27 disulfide bond)

32

95.12%

C₁₄₅H₂₃₄N₅₂O₄₄S₃

3505.91

115966-23-9

405116874

Synthetic

Powder

Urodilatin, a 32 amino acid peptide, has originally been isolated from human urine. It belongs to the family of natriuretic-vasorelaxant peptides earlier found in heart atria. Cedidi et al. showed that urodilatin infusion may represent a concept for the treatment of therapy-resistant acute renal failure after liver transplantation.The use of H-3046 is protected by patents. It is sold by Hanhong for research purposes only, by expressed permission of Pharis Biotec GmbH, Hannover, Germany (www.

Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides

• M.Gagelmann et al., FEBS Lett., 233, 249 (1988)
• V.di Marzo et al., Trends Pharmacol. Sci., 10, 91 (1989)
• A.J.Kenny et al., Biochem. J., 291, 83 (1993)
• T.Fluge et al., Eur. J. Pharmacol., 271, 395 (1994)
• C.Cedidi et al., Eur. J. Clin. Invest., 24, 632 (1994)

Trifluoroacetic acid (TFA) is a common counterion from the purification process using High-Performance Liquid Chromatography (HPLC). The presence of TFA can affect the peptide's net weight, appearance, and solubility.

Impact on Net Weight: The TFA salt contributes to the total mass of the product. In most cases, the peptide content constitutes >80% of the total weight, with TFA accounting for the remainder.

Solubility: TFA salts generally enhance the solubility of peptides in aqueous solutions.

In Biological Assays: For most standard in vitro assays, the residual TFA levels do not cause interference. However, for highly sensitive cellular or biochemical studies, please be aware of its presence.