RNase 7 (1-45aa) peptide

RNase 7 (1-45aa) peptide

• Handling and Storage of Synthetic Peptides
• Material Safety Data Sheets (MSDS)

Batch to batch variation of the purity

H-RPRGMTSSQWFRIQHMQPSPQASNSAMRNINRHTRRSRDLNTFLH-OH

H-Arg-Pro-Arg-Gly-Met-Thr-Ser-Ser-Gln-Trp-Phe-Arg-Ile-Gln-His-Met-Gln-Pro-Ser-Pro-Gln-Ala-Ser-Asn-Ser-Ala-Met-Arg-Asn-Ile-Asn-Arg-His-Thr-Arg-Arg-Ser-Arg-Asp-Leu-Asn-Thr-Phe-Leu-His-OH

45

95.2%

C₂₂₇H₃₆₄N₈₄O₆₅S₃

5406.01

Synthetic

Powder

Candida albicans is a polymorphic fungus responsible for mucosal and skin infections. Candida cells form biofilm communities resistant to most currently available antifungal agents. Two human ribonucleases from the vertebrate-specific RNaseA superfamily, hRNase3 and hRNase7, exhibit high anticandidal activity. The N-terminal region of these RNases reproduces much of the parental protein's bactericidal activity. N-terminal derived peptides corresponding to the eight human canonical RNases (RN1-8) were tested against planktonic cells and biofilms of C. albicans. RN3 and RN7 peptides displayed the most potent inhibitory effect, characterized by cell-wall binding, membrane permeabilization, and biofilm eradication activities.

Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides

• Salazar VA, Arranz-Trullu00e9n J, Prats-Ejarque G, et al. Insight into the Antifungal Mechanism of Action of Human RNase N-terminus Derived Peptides. Int J Mol Sci. 2019;20(18):4558. Published 2019 Sep 14. doi:10.3390/ijms20184558

Trifluoroacetic acid (TFA) is a common counterion from the purification process using High-Performance Liquid Chromatography (HPLC). The presence of TFA can affect the peptide's net weight, appearance, and solubility.

Impact on Net Weight: The TFA salt contributes to the total mass of the product. In most cases, the peptide content constitutes >80% of the total weight, with TFA accounting for the remainder.

Solubility: TFA salts generally enhance the solubility of peptides in aqueous solutions.

In Biological Assays: For most standard in vitro assays, the residual TFA levels do not cause interference. However, for highly sensitive cellular or biochemical studies, please be aware of its presence.