Px-Moricin peptide

Px-Moricin peptide

• Handling and Storage of Synthetic Peptides
• Material Safety Data Sheets (MSDS)

Batch to batch variation of the purity

H-APKVNVNALKKGGRVIKKGLGVIGAAGTAHEVYNHVRNRNQG-NH2

H-Ala-Pro-Lys-Val-Asn-Val-Asn-Ala-Leu-Lys-Lys-Gly-Gly-Arg-Val-Ile-Lys-Lys-Gly-Leu-Gly-Val-Ile-Gly-Ala-Ala-Gly-Thr-Ala-His-Glu-Val-Tyr-Asn-His-Val-Arg-Asn-Arg-Asn-Gln-Gly-NH2

42

95.2%

C₁₉₁H₃₂₅N₆₇O₅₂

4392.02

Synthetic

Powder

Px-Moricin is a novel AMP moricin from diamondback moth (Plutella xylostella). Px-Mor exhibited a broad antimicrobial spectrum against Gram positive bacteria (GPB), Gram negative bacteria (GNB) and fungi. Moreover, scanning electron microscopy and transmission electron microscopy (TEM) revealed that Px-Mor can cause obvious morphological alterations in A. pullulans, which demonstrated its powerful effect on the mycelia growth inhibition. The relative expression levels of Px-Mor were highest in fourth instar and prepupa stage, suggesting that moricin played different roles at different developmental stages. Px-Mor may be mainly expressed in changeable period of metamorphosis of prepupa development, which illustrated that Moricin have certain biological significance during the process of metamorphosis.

Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides

• Xu X, Zhong A, Wang Y, et al. Molecular Identification of a Moricin Family Antimicrobial Peptide (Px-Mor) From Plutella xylostella With Activities Against the Opportunistic Human Pathogen Aureobasidium pullulans. Front Microbiol. 2019

Trifluoroacetic acid (TFA) is a common counterion from the purification process using High-Performance Liquid Chromatography (HPLC). The presence of TFA can affect the peptide's net weight, appearance, and solubility.

Impact on Net Weight: The TFA salt contributes to the total mass of the product. In most cases, the peptide content constitutes >80% of the total weight, with TFA accounting for the remainder.

Solubility: TFA salts generally enhance the solubility of peptides in aqueous solutions.

In Biological Assays: For most standard in vitro assays, the residual TFA levels do not cause interference. However, for highly sensitive cellular or biochemical studies, please be aware of its presence.