Plantaricin NC8 peptide

Plantaricin NC8 peptide

• COA/MS/HPLC Report
• Handling and Storage of Synthetic Peptides
• Material Safety Data Sheets (MSDS)

Batch to batch variation of the purity

LTTKLWSSWGYYLGKKARWNLKHPYVQF

H-Leu-Thr-Thr-Lys-Leu-Trp-Ser-Ser-Trp-Gly-Tyr-Tyr-Leu-Gly-Lys-Lys-Ala-Arg-Trp-Asn-Leu-Lys-His-Pro-Tyr-Val-Gln-Phe-OH

28

95.21%

C₁₆₉H₂₄₄N₄₂O₃₈

3472.02

Synthetic

Powder

A two-chain bacteriocin which requires chain B for optimal activity. The sequence of chain B is SVPTSVYTLGIKILWSAYKHRKTIEKSFNKGFYH. In addition, downstream of Pln NC8, it is likely there is another two chain bacteriocin named plantaricin J51. Whether it is a true bacteriocin remains to be established (Diep DB et al, 2009). Plantaricin NC8 has Antimicrobial activity. The source of Plantaricin NC8 is Lactobacillus plantarum NC8.

Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides

• Maldonado A, Ruiz-Barba JL, Jiménez-Díaz R. Purification and genetic characterization of plantaricin NC8, a novel coculture-inducible two-peptide bacteriocin from Lactobacillus plantarum NC8. Appl Environ Microbiol. 2003 Jan;69(1):383-9.

Trifluoroacetic acid (TFA) is a common counterion from the purification process using High-Performance Liquid Chromatography (HPLC). The presence of TFA can affect the peptide's net weight, appearance, and solubility.

Impact on Net Weight: The TFA salt contributes to the total mass of the product. In most cases, the peptide content constitutes >80% of the total weight, with TFA accounting for the remainder.

Solubility: TFA salts generally enhance the solubility of peptides in aqueous solutions.

In Biological Assays: For most standard in vitro assays, the residual TFA levels do not cause interference. However, for highly sensitive cellular or biochemical studies, please be aware of its presence.