NovoPro
Cart 2
  • PD-LYSO

PD-LYSO

Cat.#: 318740

Size:
Optional Service: TFA RemovalWhat's this?

Special Price 350.0 USD

Availability: 5 weeks
- +

Add to cart to get an online quotation

Product Information

  • Product Name
    PD-LYSO
  • Documents
  • Quantity/Unit
    1 Vial
  • Sequence
    H-DKEMAATSAAIEDAVRRIEDMMNQYPYDVPDYAMDFSGLSLIKLKKQ-OH
  • Three letter code
    H-Asp-Lys-Glu-Met-Ala-Ala-Thr-Ser-Ala-Ala-Ile-Glu-Asp-Ala-Val-Arg-Arg-Ile-Glu-Asp-Met-Met-Asn-Gln-Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala-Met-Asp-Phe-Ser-Gly-Leu-Ser-Leu-Ile-Lys-Leu-Lys-Lys-Gln-OH
  • Length (aa)
    47
  • Peptide Purity (HPLC)
    95.2
  • Molecular Formula
    C234H372N60O76S4
  • Molecular Weight
    5370.04
  • Source
    Synthetic
  • Additional Information
  • Storage Guidelines
    Ideally PD-LYSO should be stored in a freezer at or below -9C. PD-LYSO should be refrigerated after reconstitution. For more details, please refer to the manual:Handling and Storage of Synthetic Peptides
  • References
    • Wang H, Yao H, Li C, et al. HIP1R targets PD-L1 to lysosomal degradation to alter T cell-mediated cytotoxicity. Nat Chem Biol. 2018
  • About TFA salt

    Trifluoroacetic acid (TFA) is a strong acid, which is commonly used to cleave synthesized peptides from solid-phase resins and is also used to improve HPLC performance in the peptide purification step. By default, custom peptides are delivered as lyophilized TFA salts, and can contain as much as 10-45% TFA.

    TFA in custom peptides can cause inexplicable discrepancies in subsequent assay data. For instance, TFA in nM concentrations has been shown to interfere with cellular assays, inhibiting cellular proliferation in some instances, and increasing cell viability in others . It has also been found to be an unintended allosteric modulator of the glycine receptor, GlyR.

    TFA Removal Service is recommended for:

    • Peptides that will be used in cellular assays
    • Peptides that will be used as APIs or in manufactured products
    • For hydrophilic peptides containing numerous basic residues

Peptide Property

  • Analysed Sequence:H-DKEMAATSAAIEDAVRRIEDMMNQYPYDVPDYAMDFSGLSLIKLKKQ-OH
  • Chemical Formula:C234H372N60O76S4
  • Sequence length:47
  • Extinction coefficient:3840 M-1cm-1
  • GRAVY:-0.48
  • Mw average:5370.04
  • Theoretical pI:4.31
  • Data Source:Peptide Property Calculator

GRAVY = grand average of hydropathy

Red: Hydrophobic uncharged residues, like F I L M V W A and P

Blue: Basic residues, like R K H and N-terminal -NH2

Green: Acidic residues, like D E and C-terminal -COOH

Black: Polar uncharged residues, like G S T C N Q and Y

Peptide Services: NovoPro's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.

Standard Peptide Synthesis: NovoPro offers quality peptides at the most competitive prices in the industry, starting at $3.20 per amino acid. NovoPro provides PepBox – Automatic Quote Tool for online price calculation.

Peptide Modifications: NovoPro offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"