Papiliocin peptide

Papiliocin peptide

• COA/MS/HPLC Report
• Handling and Storage of Synthetic Peptides
• Material Safety Data Sheets (MSDS)

Batch to batch variation of the purity

H-RWKIFKKIEKVGRNVRDGIIKAGPAVAVVGQAATVVK-NH2

Arg-Trp-Lys-Ile-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Arg-Asn-Val-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Ala-Thr-Val-Val-Lys

37

95.12%

C₁₈₃H₃₁₃N₅₅O₄₅

4002.84

Synthetic

Powder

Injection of bacterial LPS induces the production of this peptide. Although papiliocin displayed a broad antimicrobial spectrum, it is not hemolytic and especially active against Gram-negative bacteria. This cecropin-like membrane-active peptide may form a pore (2.3-3.3 nm) in the fungal membranes (J Microbiol Biotechnol. 2010 Aug;20(8):1185-8). It could also induce yeast apoptosis (Hwang B et al 2011 Biochem Biophys Res Commun. 408: 89-93). The peptide also showed antiinfammatory activities. In DPC micelles, the peptide adopted a helix-hinge-helix conformation (H1:residues 3-21 and H2: 25-36). Residues W2 and F5 are proposed to be important for LPS binding (Kim JK et al. 2011 J Biol Chem 286:41296-311). Updated 10/24/11; 12/23/11 GW. Papiliocin has Antibacterial, Antifungal activity. The source of Papiliocin is the swallowtail butterfly, Papilio xuthus.

Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides

• Kim JK, Lee E, Shin S, Jeong KW, Lee JY, Bae SY, Kim SH, Lee J, Kim SR, Lee DG, Hwang JS, Kim Y. Structure and function of papiliocin with antimicrobial and anti-inflammatory activities isolated from the swallowtail butterfly, Papilio xuthus. J Biol Chem. 2011 Dec 2;286(48):41296-41311. doi: 10.1074/jbc.M111.269225. Epub 2011 Sep 29. PMID: 21965682; PMCID: PMC3308842.

Trifluoroacetic acid (TFA) is a common counterion from the purification process using High-Performance Liquid Chromatography (HPLC). The presence of TFA can affect the peptide's net weight, appearance, and solubility.

Impact on Net Weight: The TFA salt contributes to the total mass of the product. In most cases, the peptide content constitutes >80% of the total weight, with TFA accounting for the remainder.

Solubility: TFA salts generally enhance the solubility of peptides in aqueous solutions.

In Biological Assays: For most standard in vitro assays, the residual TFA levels do not cause interference. However, for highly sensitive cellular or biochemical studies, please be aware of its presence.