Neuropeptide Y (human, rat)

Neuropeptide Y (human, rat)

• Handling and Storage of Synthetic Peptides
• Material Safety Data Sheets (MSDS)

Batch to batch variation of the purity

H-YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2

H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2

36

95.5%

C₁₈₉H₂₈₅N₅₅O₅₇S

4271.66

Synthetic

Powder

Neuropeptide Y (human, rat) is a widely distributed endogenous neuropeptide which mediates its physiological effects through at least four receptors, Y1, Y2, Y4, and Y5. Neuropeptide Y (human, rat) is one of the most abundant peptides in the central nervous system and is highly conserved throughout evolution. Neuropeptide Y (human, rat) is involved in a range of biochemical processes including appetite control, sexual behaviour and blood pressure regulation.

Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides

• Michel et al (1998) XVI. International Union of Pharmacology recommendations for the nomenclature of neuropeptide Y, peptide YY, and pancreatic polypeptide receptors. Pharmacol.Rev. 50 143 PMID: 9549761
• Morales-Medina et al (2010) A possible role of neuropeptide Y in depression and stress. Brain Res. 1314 194 PMID: 19782662
• Holzer et al (2012) Neuropeptide Y, peptide YY and pancreatic polypeptide in the gut-brain axis. Neuropeptides 2012 46(6) 261 PMID: 22979996

Trifluoroacetic acid (TFA) is a common counterion from the purification process using High-Performance Liquid Chromatography (HPLC). The presence of TFA can affect the peptide's net weight, appearance, and solubility.

Impact on Net Weight: The TFA salt contributes to the total mass of the product. In most cases, the peptide content constitutes >80% of the total weight, with TFA accounting for the remainder.

Solubility: TFA salts generally enhance the solubility of peptides in aqueous solutions.

In Biological Assays: For most standard in vitro assays, the residual TFA levels do not cause interference. However, for highly sensitive cellular or biochemical studies, please be aware of its presence.