Neuropeptide Y homolog (Drosophila NPF)

Neuropeptide Y homolog (Drosophila NPF)

• Handling and Storage of Synthetic Peptides
• Material Safety Data Sheets (MSDS)

Batch to batch variation of the purity

H-SNSRPPRKNDVNTMADAYKFLQDLDTYYGDRARVRF-NH2

H-Ser-Asn-Ser-Arg-Pro-Pro-Arg-Lys-Asn-Asp-Val-Asn-Thr-Met-Ala-Asp-Ala-Tyr-Lys-Phe-Leu-Gln-Asp-Leu-Asp-Thr-Tyr-Tyr-Gly-Asp-Arg-Ala-Arg-Val-Arg-Phe-NH2

36

95.04%

C₁₈₆H₂₈₈N₅₈O₅₇S

4280.67

Synthetic

Powder

Drosophila NPF appears to be a homolog of vertebrate Neuropeptide Y. Neuropeptide F/Y signaling regulates physiological processes including feeding behavior, metabolism, reproduction, and stress responses both in vertebrates and invertebrates, and there is extensive literature implicating neuropeptide F signaling in clock function, learning, appetite, and growth in Drosophila.

Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides

• Chintapalli VR, Terhzaz S, Wang J, Al Bratty M, Watson DG, Herzyk P, Davies SA, Dow JA. Functional correlates of positional and gender-specific renal asymmetry in Drosophila. PLoS One. 2012;7(4):e32577.

Trifluoroacetic acid (TFA) is a common counterion from the purification process using High-Performance Liquid Chromatography (HPLC). The presence of TFA can affect the peptide's net weight, appearance, and solubility.

Impact on Net Weight: The TFA salt contributes to the total mass of the product. In most cases, the peptide content constitutes >80% of the total weight, with TFA accounting for the remainder.

Solubility: TFA salts generally enhance the solubility of peptides in aqueous solutions.

In Biological Assays: For most standard in vitro assays, the residual TFA levels do not cause interference. However, for highly sensitive cellular or biochemical studies, please be aware of its presence.