NovoPro
Cart 2
  • Neuropeptide EI-Gly-Arg-Arg-MCH (human, mouse, rat)

Neuropeptide EI-Gly-Arg-Arg-MCH (human, mouse, rat)

Cat.#: 301157

Size:
Optional Service: TFA RemovalWhat's this?

Special Price 502.5 USD

Availability: 4 weeks
- +

Add to cart to get an online quotation

Product Information

  • Product Name
    Neuropeptide EI-Gly-Arg-Arg-MCH (human, mouse, rat)
  • Documents
  • Quantity/Unit
    1 Vial
  • Sequence
    EIGDEENSAKFPIGRRDFDMLRCMLGRVYRPCWQV
  • Three letter code
    H-Glu-Ile-Gly-Asp-Glu-Glu-Asn-Ser-Ala-Lys-Phe-Pro-Ile-Gly-Arg-Arg-Asp-Phe-Asp-Met-Leu-Arg-Cys-Met-Leu-Gly-Arg-Val-Tyr-Arg-Pro-Cys-Trp-Gln-Val-OH
  • Length (aa)
    35
  • Peptide Purity (HPLC)
    96.5
  • Molecular Formula
    C182H282N54O52S4
  • Molecular Weight
    4186.84
  • Source
    Synthetic
  • Additional Information
    Neuropeptide EI-Gly-Arg-Arg-MCH (human, mouse, rat) has been shown to be more potent in stimulating feeding in the rat than MCH (H-1482) following intracerebroventricular administration although it did not exhibit better agonist activity in in vitro assays. Its enhanced activity in feeding behaviour compared to MCH might be due to its reduced susceptibility to proteolytic degradation by MCH-degrading enzymes such as endopeptidase 24.11 and aminopeptidase M.
  • Storage Guidelines
    Ideally Neuropeptide EI-Gly-Arg-Arg-MCH (human, mouse, rat) should be stored in a freezer at or below -9C. Neuropeptide EI-Gly-Arg-Arg-MCH (human, mouse, rat) should be refrigerated after reconstitution. For more details, please refer to the manual:Handling and Storage of Synthetic Peptides
  • References
    • A.Viale et al., J. Biol. Chem., 274, 6536 (1999)
    • L.Maulon-Feraille et al., J. Pharmacol. Exp. Ther., 302, 766 (2002)
  • About TFA salt

    Trifluoroacetic acid (TFA) is a strong acid, which is commonly used to cleave synthesized peptides from solid-phase resins and is also used to improve HPLC performance in the peptide purification step. By default, custom peptides are delivered as lyophilized TFA salts, and can contain as much as 10-45% TFA.

    TFA in custom peptides can cause inexplicable discrepancies in subsequent assay data. For instance, TFA in nM concentrations has been shown to interfere with cellular assays, inhibiting cellular proliferation in some instances, and increasing cell viability in others . It has also been found to be an unintended allosteric modulator of the glycine receptor, GlyR.

    TFA Removal Service is recommended for:

    • Peptides that will be used in cellular assays
    • Peptides that will be used as APIs or in manufactured products
    • For hydrophilic peptides containing numerous basic residues

Peptide Property

  • Analysed Sequence:H-EIGDEENSAKFPIGRRDFDMLRCMLGRVYRPCWQV-OH
  • Chemical Formula:C182H282N54O52S4
  • Sequence length:35
  • Extinction coefficient:7090 M-1cm-1
  • GRAVY:-0.59
  • Mw average:4186.76
  • Theoretical pI:6.45
  • Data Source:Peptide Property Calculator

GRAVY = grand average of hydropathy

Red: Hydrophobic uncharged residues, like F I L M V W A and P

Blue: Basic residues, like R K H and N-terminal -NH2

Green: Acidic residues, like D E and C-terminal -COOH

Black: Polar uncharged residues, like G S T C N Q and Y

Peptide Services: NovoPro's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.

Standard Peptide Synthesis: NovoPro offers quality peptides at the most competitive prices in the industry, starting at $3.20 per amino acid. NovoPro provides PepBox – Automatic Quote Tool for online price calculation.

Peptide Modifications: NovoPro offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"