NovoPro
Cart 2
  • Antibacterial Protein LL-37 amide (human), LL37, CAMP

Antibacterial Protein LL-37 amide (human), LL37, CAMP

Cat.#: 308114

Size:
Optional Service: TFA RemovalWhat's this?

Special Price 425.5 USD

Availability: 4 weeks
- +

Add to cart to get an online quotation

Product Information

  • Product Name
    Antibacterial Protein LL-37 amide (human), LL37, CAMP
  • Documents
  • Quantity/Unit
    1 Vial
  • Sequence
    LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
  • Three letter code
    H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-NH2
  • Length (aa)
    37
  • Peptide Purity (HPLC)
    96.9
  • Molecular Formula
    C205H341N61O52
  • Molecular Weight
    4492.34
  • Source
    Synthetic
  • Additional Information
    LL-37 is an antimicrobial peptide with angiogenic activity. It corresponds to amino acids 134-170 of the human cathelicidin antimicrobial protein hCAP18/LL-37 and is extracellularly released from hCAP18/LL-37 by proteolytic processing. hCAP18/LL-37 is an effector of the innate immune system and is expressed in leukocytes and epithelial cells where it is upregulated in association with inflammation and injury. An overexpression of hCAP18/LL-37 in a series of breast carcinomas could be demonstated
  • Storage Guidelines
    Ideally Antibacterial Protein LL-37 amide (human), LL37, CAMP should be stored in a freezer at or below -9C. Antibacterial Protein LL-37 amide (human), LL37, CAMP should be refrigerated after reconstitution. For more details, please refer to the manual:Handling and Storage of Synthetic Peptides
  • References
    • S.Sandgren et al., J. Biol. Chem., 279, 17951 (2004)
    • F.Neville et al., Biophys. J., 90, 1275 (2006)
    • U.H.Durr et al., Biochim. Biophys. Acta, 1758, 1408 (2006)
    • T.Tecle et al., Innate Immun., 16, 151 (2010)
  • About TFA salt

    Trifluoroacetic acid (TFA) is a strong acid, which is commonly used to cleave synthesized peptides from solid-phase resins and is also used to improve HPLC performance in the peptide purification step. By default, custom peptides are delivered as lyophilized TFA salts, and can contain as much as 10-45% TFA.

    TFA in custom peptides can cause inexplicable discrepancies in subsequent assay data. For instance, TFA in nM concentrations has been shown to interfere with cellular assays, inhibiting cellular proliferation in some instances, and increasing cell viability in others . It has also been found to be an unintended allosteric modulator of the glycine receptor, GlyR.

    TFA Removal Service is recommended for:

    • Peptides that will be used in cellular assays
    • Peptides that will be used as APIs or in manufactured products
    • For hydrophilic peptides containing numerous basic residues

Peptide Property

  • Analysed Sequence:H-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-Amidation
  • Chemical Formula:C205H341N61O52
  • Sequence length:37
  • Extinction coefficient:0 M-1cm-1
  • GRAVY:-0.72
  • Mw average:4492.26
  • Theoretical pI:11.1
  • Data Source:Peptide Property Calculator

GRAVY = grand average of hydropathy

Red: Hydrophobic uncharged residues, like F I L M V W A and P

Blue: Basic residues, like R K H and N-terminal -NH2

Green: Acidic residues, like D E and C-terminal -COOH

Black: Polar uncharged residues, like G S T C N Q and Y

Peptide Services: NovoPro's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.

Standard Peptide Synthesis: NovoPro offers quality peptides at the most competitive prices in the industry, starting at $3.20 per amino acid. NovoPro provides PepBox – Automatic Quote Tool for online price calculation.

Peptide Modifications: NovoPro offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"