Antibacterial peptide LL-37 amide, LL37

Antibacterial peptide LL-37 amide, LL37

• COA/MS/HPLC Report
• Handling and Storage of Synthetic Peptides
• Material Safety Data Sheets (MSDS)

Batch to batch variation of the purity

LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-NH2

H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-NH2

37

95.55%

C₂₀₅H₃₄₁N₆₁O₅₂

4492.28

597562-32-8

Synthetic

Powder

LL-37 is a 37-residue amphiphilic histidine-derived antimicrobial peptide with broad antimicrobial activity. LL-37 helps protect the cornea from infections and modulates wound healing, while exhibiting antibacterial and anti-biofilm activity against a variety of Gram-positive and Gram-negative human pathogens, and has wound-healing effects on the host. LL-37 is an antimicrobial peptide with angiogenic activity. It corresponds to amino acids 134-170 of the human cathelicidin antimicrobial protein hCAP18/LL-37 and is extracellularly released from hCAP18/LL-37 by proteolytic processing. hCAP18/LL-37 is an effector of the innate immune system and is expressed in leukocytes and epithelial cells where it is upregulated in association with inflammation and injury. An overexpression of hCAP18/LL-37 in a series of breast carcinomas could be demonstated

Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides

• S.Sandgren et al., J. Biol. Chem., 279, 17951 (2004)
• F.Neville et al., Biophys. J., 90, 1275 (2006)
• U.H.Durr et al., Biochim. Biophys. Acta, 1758, 1408 (2006)
• T.Tecle et al., Innate Immun., 16, 151 (2010)

Trifluoroacetic acid (TFA) is a common counterion from the purification process using High-Performance Liquid Chromatography (HPLC). The presence of TFA can affect the peptide's net weight, appearance, and solubility.

Impact on Net Weight: The TFA salt contributes to the total mass of the product. In most cases, the peptide content constitutes >80% of the total weight, with TFA accounting for the remainder.

Solubility: TFA salts generally enhance the solubility of peptides in aqueous solutions.

In Biological Assays: For most standard in vitro assays, the residual TFA levels do not cause interference. However, for highly sensitive cellular or biochemical studies, please be aware of its presence.