LCI peptide

LCI peptide

• Handling and Storage of Synthetic Peptides
• Material Safety Data Sheets (MSDS)

Batch to batch variation of the purity

H-AIKLVQSPNGNFAASFVLDGTKWIFKSKYYDSSKGYWVGIYEVWDRK-NH2

H-Ala-Ile-Lys-Leu-Val-Gln-Ser-Pro-Asn-Gly-Asn-Phe-Ala-Ala-Ser-Phe-Val-Leu-Asp-Gly-Thr-Lys-Trp-Ile-Phe-Lys-Ser-Lys-Tyr-Tyr-Asp-Ser-Ser-Lys-Gly-Tyr-Trp-Val-Gly-Ile-Tyr-Glu-Val-Trp-Asp-Arg-Lys-NH2

47

95.16%

C₂₅₉H₃₇₉N₆₃O₆₈

5463.13

Synthetic

Powder

Peptide LCI is an adhesion-promoting peptide used in the Matter-tag-based enzyme immobilization platform. It contains several basic and acidic amino acids such as Asp and Arg, which are polar in nature and may be involved in interaction with various materials including polymers, metals, and silicon-based materials. LCI was identified as a universal adhesion promoter and was able to immobilize both enzymes (phytase and cellulase) on all investigated materials. Studies suggest that the adsorption behavior of a peptide can be largely electrostatic, and the polar residues in LCI may contribute to the adsorption energy on stainless steel and gold surfaces.

Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides

• Dedisch S, Wiens A, Davari MD, Söder D, Rodriguez-Emmenegger C, Jakob F, Schwaneberg U. Matter-tag: A universal immobilization platform for enzymes on polymers, metals, and silicon-based materials. Biotechnol Bioeng. 2020 Jan;117(1):49-61. doi: 10.1002/bit.27181. Epub 2019 Oct 9. PMID: 31549734.

Trifluoroacetic acid (TFA) is a common counterion from the purification process using High-Performance Liquid Chromatography (HPLC). The presence of TFA can affect the peptide's net weight, appearance, and solubility.

Impact on Net Weight: The TFA salt contributes to the total mass of the product. In most cases, the peptide content constitutes >80% of the total weight, with TFA accounting for the remainder.

Solubility: TFA salts generally enhance the solubility of peptides in aqueous solutions.

In Biological Assays: For most standard in vitro assays, the residual TFA levels do not cause interference. However, for highly sensitive cellular or biochemical studies, please be aware of its presence.