Glicentin (By similarity) peptide

Glicentin (By similarity) peptide

• COA/MS/HPLC Report
• Handling and Storage of Synthetic Peptides
• Material Safety Data Sheets (MSDS)

Batch to batch variation of the purity

RSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA

Arg-Ser-Leu-Gln-Asp-Thr-Glu-Glu-Lys-Ser-Arg-Ser-Phe-Ser-Ala-Ser-Gln-Ala-Asp-Pro-Leu-Ser-Asp-Pro-Asp-Gln-Met-Asn-Glu-Asp-Lys-Arg-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Arg-Asn-Asn-Ile-Ala

69

90.05%

C₃₄₀H₅₃₂N₁₀₈O₁₁₉S₂

8100.6

Synthetic

Powder

Glicentin (By similarity) belongs to Glucagon. Glicentin (By similarity) is expressed in Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP-1 and GLP-2 are also secreted in selected neurons in the brain. Glicentin is a 69-amino-acid peptide containing glucagon and oxyntomodulin sequences in the molecule. Glicentin is a major form of gut glucagon-like immunoreactants (Gut GLIs). In mammalian small intestine, proglucagon is processed into glicentin, oxyntomodulin, and glucagon -like peptide 1(GLP-1) and glucagon -like peptide 2 (GLP-2). GLP-1(7–37) and GLP-1(7–36)amide have been isolated from the intestine and pancreas. It has been known that the GLP-1 sequence is well conserved between species in all mammals studied. Using synthetic peptides, several investigators have demonstrated that in contrast to GLP-1 (1–37), truncated GLP-1(7–36)amide and GLP-1(7–37) have several physiological effects.

Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides

• Holst JJ. Evidence that glicentin contains the entire sequence of glucagon. Biochem J. 1980;187(2):337-43

Trifluoroacetic acid (TFA) is a common counterion from the purification process using High-Performance Liquid Chromatography (HPLC). The presence of TFA can affect the peptide's net weight, appearance, and solubility.

Impact on Net Weight: The TFA salt contributes to the total mass of the product. In most cases, the peptide content constitutes >80% of the total weight, with TFA accounting for the remainder.

Solubility: TFA salts generally enhance the solubility of peptides in aqueous solutions.

In Biological Assays: For most standard in vitro assays, the residual TFA levels do not cause interference. However, for highly sensitive cellular or biochemical studies, please be aware of its presence.