NovoPro
Cart 2
  • Glicentin (By similarity)

Glicentin (By similarity)

Cat.#: 316876

Size:
Optional Service: TFA RemovalWhat's this?

Special Price 498.0 USD

Availability: 7 weeks
- +

Add to cart to get an online quotation

Product Information

  • Product Name
    Glicentin (By similarity)
  • Documents
  • Quantity/Unit
    1 Vial
  • Sequence
    RSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
  • Three letter code
    Arg-Ser-Leu-Gln-Asp-Thr-Glu-Glu-Lys-Ser-Arg-Ser-Phe-Ser-Ala-Ser-Gln-Ala-Asp-Pro-Leu-Ser-Asp-Pro-Asp-Gln-Met-Asn-Glu-Asp-Lys-Arg-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Arg-Asn-Asn-Ile-Ala
  • Length (aa)
    69
  • Peptide Purity (HPLC)
    90.0
  • Molecular Formula
    C340H532N108O119S2
  • Molecular Weight
    8100.68
  • Source
    Synthetic
  • Additional Information
    Glicentin (By similarity) belongs to Glucagon. Glicentin (By similarity) is expressed in Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP-1 and GLP-2 are also secreted in selected neurons in the brain. Glicentin is a 69-amino-acid peptide containing glucagon and oxyntomodulin sequences in the molecule. Glicentin is a major form of gut glucagon-like immunoreactants (Gut GLIs). In mammalian small intestine, proglucagon is processed into glicentin, oxyntomodulin, and glucagon -like peptide 1(GLP-1) and glucagon -like peptide 2 (GLP-2). GLP-1(7–37) and GLP-1(7–36)amide have been isolated from the intestine and pancreas. It has been known that the GLP-1 sequence is well conserved between species in all mammals studied. Using synthetic peptides, several investigators have demonstrated that in contrast to GLP-1 (1–37), truncated GLP-1(7–36)amide and GLP-1(7–37) have several physiological effects.
  • Storage Guidelines
    Ideally Glicentin (By similarity) should be stored in a freezer at or below -9C. Glicentin (By similarity) should be refrigerated after reconstitution. For more details, please refer to the manual:Handling and Storage of Synthetic Peptides
  • About TFA salt

    Trifluoroacetic acid (TFA) is a strong acid, which is commonly used to cleave synthesized peptides from solid-phase resins and is also used to improve HPLC performance in the peptide purification step. By default, custom peptides are delivered as lyophilized TFA salts, and can contain as much as 10-45% TFA.

    TFA in custom peptides can cause inexplicable discrepancies in subsequent assay data. For instance, TFA in nM concentrations has been shown to interfere with cellular assays, inhibiting cellular proliferation in some instances, and increasing cell viability in others . It has also been found to be an unintended allosteric modulator of the glycine receptor, GlyR.

    TFA Removal Service is recommended for:

    • Peptides that will be used in cellular assays
    • Peptides that will be used as APIs or in manufactured products
    • For hydrophilic peptides containing numerous basic residues

Peptide Property

  • Analysed Sequence:H-RSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-OH
  • Chemical Formula:C340H532N108O119S2
  • Sequence length:69
  • Extinction coefficient:8250 M-1cm-1
  • GRAVY:-1.48
  • Mw average:8100.6
  • Theoretical pI:7.66
  • Data Source:Peptide Property Calculator

GRAVY = grand average of hydropathy

Red: Hydrophobic uncharged residues, like F I L M V W A and P

Blue: Basic residues, like R K H and N-terminal -NH2

Green: Acidic residues, like D E and C-terminal -COOH

Black: Polar uncharged residues, like G S T C N Q and Y

Peptide Services: NovoPro's peptide synthesis services include standard chemical peptide synthesis, peptide modification, peptide libraries, and recombinant peptide expression.

Standard Peptide Synthesis: NovoPro offers quality peptides at the most competitive prices in the industry, starting at $3.20 per amino acid. NovoPro provides PepBox – Automatic Quote Tool for online price calculation.

Peptide Modifications: NovoPro offers a wide range of peptide modification services including isotope labeling (2H, 15N, and 13C), multiple disulfide bonds, multiple phosphorylations, KLH, BSA, ovalbumin, amidation, acetylation, biotin, FITC, etc.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"