GIP (porcine) peptide

GIP (porcine) peptide

• Handling and Storage of Synthetic Peptides
• Material Safety Data Sheets (MSDS)

Batch to batch variation of the purity

H-YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ-OH

H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Ser-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH

42

95.14%

C₂₂₅H₃₄₂N₆₀O₆₆S

4975.52

Synthetic

Powder

GIP is a member of a family of structurally related hormones that includes secretin, glucagon, and vasoactive intestinal peptide. GIP (human) differs from GIP (porcine) at residues 18 and 34. GIP is secreted from specific endocrine cells (K-cells) in the epithelium of the upper part of small intestine after ingestion of food. Once released, GIP is subjected to NH2-terminal degradation by dipeptidyl peptidase-IV (DPP-IV), yielding GIP (3-42) as the primary metabolite which acts as a GIP receptor antagonist.

Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides

• Wolffbrandt et al (1986) The effects of porcine GIP on insulin secretion and glucose clearance in the pig. Horm Metab Res. 18(3) 159 PMID: 3516832
• Yamada et al (2006) Pancreatic and Extrapancreatic Effects of Gastric Inhibitory Polypeptide. Diabetes 55 (Supplement 2) S86 DOI: 10.2337/db06-S011
• Marks (2020) The early history of GIP 1969-2000: From enterogastrone to major metabolic hormone. Peptides 125 170276 PMID: 32081451

Trifluoroacetic acid (TFA) is a common counterion from the purification process using High-Performance Liquid Chromatography (HPLC). The presence of TFA can affect the peptide's net weight, appearance, and solubility.

Impact on Net Weight: The TFA salt contributes to the total mass of the product. In most cases, the peptide content constitutes >80% of the total weight, with TFA accounting for the remainder.

Solubility: TFA salts generally enhance the solubility of peptides in aqueous solutions.

In Biological Assays: For most standard in vitro assays, the residual TFA levels do not cause interference. However, for highly sensitive cellular or biochemical studies, please be aware of its presence.