eCATH-3 peptide

eCATH-3 peptide

• Handling and Storage of Synthetic Peptides
• Material Safety Data Sheets (MSDS)

Batch to batch variation of the purity

KRFHSVGSLIQRHQQMIRDKSEATRHGIRIITRPKLLLAS

Lys-Arg-Phe-His-Ser-Val-Gly-Ser-Leu-Ile-Gln-Arg-His-Gln-Gln-Met-Ile-Arg-Asp-Lys-Ser-Glu-Ala-Thr-Arg-His-Gly-Ile-Arg-Ile-Ile-Thr-Arg-Pro-Lys-Leu-Leu-Leu-Ala-Ser

40

97.4%

Synthetic

Powder

present abundantly in uncleaved forms in horse neutrophils. Active against fungi various C. neoformans, R. rubra (MIC 9-37.5 ug/ml) in Sabouraud medium. The antibacterial and antifungal activity of eCATH3 appeared to be salt-senstitive since it had MICs of 2 to 20 mg/ml for bacterial cells in low-ionic-strength medium and is ineffective when tested up to 114 mg/ml in physiological salt medium. If the major function of eCATH3 is not antimicrobial, this peptide could possesses other non-antimicrobial functions (Skerlavaj B et al., 2001). Updated 7/8/2013. eCATH-3 has Antimicrobial activity. The source of eCATH-3 is myeloid cells, Horse Equus asinus.

Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides

• Scocchi M, Bontempo D, Boscolo S, Tomasinsig L, Giulotto E, Zanetti M. Novel cathelicidins in horse leukocytes(1). FEBS Lett. 1999;457(3):459-64.

Trifluoroacetic acid (TFA) is a common counterion from the purification process using High-Performance Liquid Chromatography (HPLC). The presence of TFA can affect the peptide's net weight, appearance, and solubility.

Impact on Net Weight: The TFA salt contributes to the total mass of the product. In most cases, the peptide content constitutes >80% of the total weight, with TFA accounting for the remainder.

Solubility: TFA salts generally enhance the solubility of peptides in aqueous solutions.

In Biological Assays: For most standard in vitro assays, the residual TFA levels do not cause interference. However, for highly sensitive cellular or biochemical studies, please be aware of its presence.