Conopeptide CPY-Fe1

Conopeptide CPY-Fe1

• Handling and Storage of Synthetic Peptides
• Material Safety Data Sheets (MSDS)

Batch to batch variation of the purity

GTYLYPFSYYRLWRYFTRFLHKQPYYYVHI

Gly-Thr-Tyr-Leu-Tyr-Pro-Phe-Ser-Tyr-Tyr-Arg-Leu-Trp-Arg-Tyr-Phe-Thr-Arg-Phe-Leu-His-Lys-Gln-Pro-Tyr-Tyr-Tyr-Val-His-Ile

30

96.9%

Synthetic

Powder

Two venom peptides, CPY-Pl1 (EU000528) and CPY-Fe1 (EU000529), characterized from the vermivorous marine snails Conus planorbis and Conus ferrugineus, define a new class of conopeptides, the conopeptide Y (CPY) family. The peptides have no disulfide cross-links and are 30 amino acids long; the high content of tyrosine is unprecedented for any native gene product. The CPY peptides were chemically synthesized and shown to be biologically active upon injection into both mice and Caenorhabditis elegans; activity on mammalian Kv1 channel isoforms was demonstrated using an oocyte heterologous expression system, and selectivity for Kv1.6 was found. NMR spectroscopy revealed that the peptides were unstructured in aqueous solution; however, a helical region including residues 12–18 for one peptide, CPY-Pl1, formed in trifluoroethanol buffer.

Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides

• Imperial JS, Chen P, Sporning A, et al. Tyrosine-rich conopeptides affect voltage-gated K+ channels. J Biol Chem. 2008;283(34):23026-32.

Trifluoroacetic acid (TFA) is a common counterion from the purification process using High-Performance Liquid Chromatography (HPLC). The presence of TFA can affect the peptide's net weight, appearance, and solubility.

Impact on Net Weight: The TFA salt contributes to the total mass of the product. In most cases, the peptide content constitutes >80% of the total weight, with TFA accounting for the remainder.

Solubility: TFA salts generally enhance the solubility of peptides in aqueous solutions.

In Biological Assays: For most standard in vitro assays, the residual TFA levels do not cause interference. However, for highly sensitive cellular or biochemical studies, please be aware of its presence.