C-type natriuretic peptide CNP-38

C-type natriuretic peptide CNP-38

• COA/MS/HPLC Report
• Handling and Storage of Synthetic Peptides
• Material Safety Data Sheets (MSDS)

Batch to batch variation of the purity

KDLSNNPLRFRGRSKKGPSRGCFGVKLDRIGAMSGLGC

H-Lys-Asp-Leu-Ser-Asn-Asn-Pro-Leu-Arg-Phe-Arg-Gly-Arg-Ser-Lys-Lys-Gly-Pro-Ser-Arg-Gly-Cys-Phe-Gly-Val-Lys-Leu-Asp-Arg-Ile-Gly-Ala-Met-Ser-Gly-Leu-Gly-Cys-OH (disulfide bond: Cys²²-Cys³⁸)

38

95.09%

C₁₇₃H₂₉₁N₅₉O₄₉S₃

4077.7

Synthetic

Powder

C-type natriuretic peptide (CNP) is a third member of the natriuretic peptide family to be identified subsequent to the identification of atrial natriuretic peptide (ANP) and brain natriuretic peptide (BNP). CNP has a considerable sequence homology to the ANP and BNP within the 17-residue ring structure formed by a disulphide bond, although it terminates at the second cysteine residue and lacks a C-terminal extension from the ring structure. This C-type natriuretic peptide CNP-38 was originally found in leopard shark (Triakis scyllaum / Triakis scylla).

Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides

• Suzuki R, Takahashi A, Takei Y. Different molecular forms of C-type natriuretic peptide isolated from the brain and heart of an elasmobranch, Triakis scyllia. J Endocrinol. 1992 Nov;135(2):317-23. doi: 10.1677/joe.0.1350317. PMID: 1474339.

Trifluoroacetic acid (TFA) is a common counterion from the purification process using High-Performance Liquid Chromatography (HPLC). The presence of TFA can affect the peptide's net weight, appearance, and solubility.

Impact on Net Weight: The TFA salt contributes to the total mass of the product. In most cases, the peptide content constitutes >80% of the total weight, with TFA accounting for the remainder.

Solubility: TFA salts generally enhance the solubility of peptides in aqueous solutions.

In Biological Assays: For most standard in vitro assays, the residual TFA levels do not cause interference. However, for highly sensitive cellular or biochemical studies, please be aware of its presence.