BNP-32 (human)/Nesiritide peptide

BNP-32 (human)/Nesiritide peptide

• Handling and Storage of Synthetic Peptides
• Material Safety Data Sheets (MSDS)

Batch to batch variation of the purity

SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: Cys10-Cys26)

H-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH (Disulfide bridge: Cys10-Cys26)

32

98%

C₁₄₃H₂₄₄N₅₀O₄₂S₄

3464.09

124584-08-3

Synthetic

Powder

Nesiritide, also known as synthetic human B-type natriuretic peptide (hBNP), is a 32-amino acid polypeptide hormone produced by recombinant DNA technology. It has the same amino acid sequence as endogenous hBNP. Nesiritide is an agonist of natriuretic peptide receptors (NPRs), with Kd values of 7.3 and 13 pM for NPR-A and NPR-C, respectively. It binds to the A-type natriuretic peptide receptor (NPR-A) on vascular smooth muscle and endothelial cells, activating cyclic GMP. This leads to smooth muscle relaxation and vasodilation.

Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides

• M.Mukoyama et al., J. Clin. Invest., 87, 1402 (1991)
• T.G.Yandle et al., J. Clin. Endocrinol. Metab., 76, 832 (1993)
• S.J.Holmes et al., J. Clin. Endocrinol. Metab., 76, 91 (1993)
• G.La Villa et al., J. Clin. Endocrinol. Metab., 78, 1166 (1994)
• H.Yoshida et al., Regul. Peptides, 61, 45 (1996)

Trifluoroacetic acid (TFA) is a common counterion from the purification process using High-Performance Liquid Chromatography (HPLC). The presence of TFA can affect the peptide's net weight, appearance, and solubility.

Impact on Net Weight: The TFA salt contributes to the total mass of the product. In most cases, the peptide content constitutes >80% of the total weight, with TFA accounting for the remainder.

Solubility: TFA salts generally enhance the solubility of peptides in aqueous solutions.

In Biological Assays: For most standard in vitro assays, the residual TFA levels do not cause interference. However, for highly sensitive cellular or biochemical studies, please be aware of its presence.