BMAP-28 peptide

BMAP-28 peptide

• Handling and Storage of Synthetic Peptides
• Material Safety Data Sheets (MSDS)

Batch to batch variation of the purity

H-GGLRSLGRKILRAWKKYGPIIVPIIRI-NH2

H-Gly-Gly-Leu-Arg-Ser-Leu-Gly-Arg-Lys-Ile-Leu-Arg-Ala-Trp-Lys-Lys-Tyr-Gly-Pro-Ile-Ile-Val-Pro-Ile-Ile-Arg-Ile-NH2

27

95.97%

C₁₄₅H₂₅₀N₄₄O₂₉

3073.8

Synthetic

Powder

BMAP-28 (GGLRSLGRKILRAWKKYGPIIVPIIRI-NH2) is a cathelicidin peptide. After implantation of the BMAP-28-coated stent, S. aureus or E. faecalis was inoculated into the bladder. The BMAP-28 coating reduced the bacterial counts for both strains compared to uncoated controls, and this level was further reduced by coadministration of vancomycin intraperitoneally.

Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides

• Cirioni, O., Giacometti, A., Ghiselli, R., Bergnach, C., Orlando, F., Mocchegiani, F., Silvestri, C., Licci, A., Skerlavaj, B., Zanetti, M., Saba, V., and Scalise, G. (2006) Pre-Treatment of Central Venous Catheters with the Cathelicidin BMAP-28 Enhances the Efficacy of Antistaphylococcal Agents in the Treatment of Experimental Catheter- Related Infection. Peptides 27, 2104-2110.

Trifluoroacetic acid (TFA) is a common counterion from the purification process using High-Performance Liquid Chromatography (HPLC). The presence of TFA can affect the peptide's net weight, appearance, and solubility.

Impact on Net Weight: The TFA salt contributes to the total mass of the product. In most cases, the peptide content constitutes >80% of the total weight, with TFA accounting for the remainder.

Solubility: TFA salts generally enhance the solubility of peptides in aqueous solutions.

In Biological Assays: For most standard in vitro assays, the residual TFA levels do not cause interference. However, for highly sensitive cellular or biochemical studies, please be aware of its presence.