ACTH (1-39) (human) peptide

ACTH (1-39) (human) peptide

• Handling and Storage of Synthetic Peptides
• Material Safety Data Sheets (MSDS)

Batch to batch variation of the purity

H-SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF-OH

H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH

39

95.74%

C₂₀₇H₃₀₈N₅₆O₅₈S

4541.04

Synthetic

Powder

ACTH (1-39) (human) is a melanocortin receptor 2 (MC2R) agonist with an EC50 of 57 pM. ACTH (1-39) (human), also known as corticotropin, is a cleavage product from the precursor proopiomelanocortin (POMC) and is a peptide hormone produced in the anterior pituitary gland upon stimulation by corticotropin releasing hormone from the hypothalamus, often in response to stress. ACTH (1-39) (human) is used to treat multiple sclerosis relapses, acting by stimulating adrenal corticosteroid production through the MC2R.

Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides

• Kapas et al (1996) Agonist and receptor binding properties of adrenocorticotropin peptides using the cloned mouse adrenocorticotropin receptor expressed in a stably transfected HeLa cell line. Endocrinology 137 3291 PMID: 8754753
• Ghaddhab et al (2017) From Bioinactive ACTH to ACTH Antagonist: The Clinical Perspective. Front Endocrinol (Lausanne) 8 17 PMID: 28228747
• Benjamins et al (2018) Melanocortin receptor subtypes are expressed on cells in the oligodendroglial lineage and signal ACTH protection. J Neurosci Res. 96(3) 427 PMID: 28877366

Trifluoroacetic acid (TFA) is a common counterion from the purification process using High-Performance Liquid Chromatography (HPLC). The presence of TFA can affect the peptide's net weight, appearance, and solubility.

Impact on Net Weight: The TFA salt contributes to the total mass of the product. In most cases, the peptide content constitutes >80% of the total weight, with TFA accounting for the remainder.

Solubility: TFA salts generally enhance the solubility of peptides in aqueous solutions.

In Biological Assays: For most standard in vitro assays, the residual TFA levels do not cause interference. However, for highly sensitive cellular or biochemical studies, please be aware of its presence.