A1P peptide

A1P peptide

• Handling and Storage of Synthetic Peptides
• Material Safety Data Sheets (MSDS)

Batch to batch variation of the purity

PPPVIKFNRPFLMWIVERDTRSILFMGKIVNPKAP

Pro-Pro-Pro-Val-Ile-Lys-Phe-Asn-Arg-Pro-Phe-Leu-Met-Trp-Ile-Val-Glu-Arg-Asp-Thr-Arg-Ser-Ile-Leu-Phe-Met-Gly-Lys-Ile-Val-Asn-Pro-Lys-Ala-Pro

35

96.9%

Synthetic

Powder

The peptide was captured from alligator plasma by a custom-built functionalized hydrogel microparticles followed by de nono sequencing by mass spectrometer. It is 33.3% SIMILAR TO hGAPDH(2-32) . Active against E. coli, P. aeruginosa (EC50 0.098 and 4.35 uM), B. cereus, and S. aureus (EC50 0.77 and 1.36 uM). A1P was found in plasma, the American Alligator, Alligator mississippiensis.

Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides

• Bishop BM, Juba ML, Devine MC, et al. Bioprospecting the American alligator (Alligator mississippiensis) host defense peptidome. PLoS ONE. 2015;10(2):e0117394.

Trifluoroacetic acid (TFA) is a common counterion from the purification process using High-Performance Liquid Chromatography (HPLC). The presence of TFA can affect the peptide's net weight, appearance, and solubility.

Impact on Net Weight: The TFA salt contributes to the total mass of the product. In most cases, the peptide content constitutes >80% of the total weight, with TFA accounting for the remainder.

Solubility: TFA salts generally enhance the solubility of peptides in aqueous solutions.

In Biological Assays: For most standard in vitro assays, the residual TFA levels do not cause interference. However, for highly sensitive cellular or biochemical studies, please be aware of its presence.