OX3402 vector (V009820)

Basic Vector Information

      • Vector Name:
      • OX3402
      • Length:
      • 10518 bp
      • Type:
      • Cloning vector
      • Source/Author:
      • Morrison NI, Simmons GS, Fu G, O'Connell S, Walker AS, Dafa'alla T, Walters M, Claus J, Tang G, Jin L, Marubbi T, Epton MJ, Harris CL, Staten RT, Miller E, Miller TA, Alphey L.

OX3402 vector Vector Map

OX340210518 bp5001000150020002500300035004000450050005500600065007000750080008500900095001000010500SV40 poly(A) signaltTAV3adhhsp70tetO3'UTRtTAV2adhhsp70tetOHr5ie1scrapsvertebrate consensus sequence for strong initiation of translation (Kozak, 1987)nuclear localization signalvertebrate consensus sequence for strong initiation of translation (Kozak, 1987)SV40phage phi-C31 attP

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

OX3402 vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported               10518 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector OX3402, complete sequence.
ACCESSION   JX242585
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 10518)
  AUTHORS   Morrison NI, Simmons GS, Fu G, O'Connell S, Walker AS, Dafa'alla T, 
            Walters M, Claus J, Tang G, Jin L, Marubbi T, Epton MJ, Harris CL, 
            Staten RT, Miller E, Miller TA, Alphey L.
  TITLE     Engineered repressible lethality for controlling the pink bollworm, 
            a lepidopteran pest of cotton
  JOURNAL   PLoS ONE 7 (12), E50922 (2012)
  PUBMED    23226548
REFERENCE   2  (bases 1 to 10518)
  AUTHORS   Luke A.
  TITLE     Direct Submission
  JOURNAL   Submitted (27-JUN-2012) Research, Oxitec Ltd, 71 Milton Park, 
            Abingdon, Oxon OX14 4RX, UK
REFERENCE   3  (bases 1 to 10518)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..10518
                     /organism="Cloning vector OX3402"
                     /mol_type="other DNA"
                     /db_xref="taxon:1235439"
     mobile_element  1..1502
                     /mobile_element_type="transposon:piggyBac"
     polyA_signal    1611..1732
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     CDS             complement(1855..2865)
                     /codon_start=1
                     /gene="tTAV3"
                     /product="transactivator"
                     /label=tTAV3
                     /protein_id="AFS63390.1"
                     /translation="MGSRLDKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWH
                     VKNKRALLDALAIEMLDRHHTHFCPLEGESWQDFLRNNAKSFRCALLSHRDGAKVHLGT
                     RPTEKQYETLENQLAFLCQQGFSLENALYALSAVGHFTLGCVLEDQEHQVAKEERETPT
                     TDSMPPLLRQAIELFDHQGAEPAFLFGLELIICGLEKQLKCESGSAYSRARTKNNYGST
                     IEGLLDLPDDDAPEEAGLAAPRLSFLPAGHTRRLSTAPPTDVSLGDELHLDGEDVAMAH
                     ADALDDFDLDMLGDGDSPGPGFTPHDSAPYGALDMADFEFEQMFTDALGIDEYGG"
     gene            complement(1855..2865)
                     /gene="tTAV3"
                     /label=tTAV3
     intron          2894..2963
                     /note="adh"
     regulatory      2970..3099
                     /regulatory_class="promoter"
                     /note="hsp70"
     regulatory      3105..3400
                     /regulatory_class="enhancer"
                     /note="tetO"
     protein_bind    3118..3388
                     /label=tetracycline response element
                     /bound_moiety="tetracycline repressor TetR"
                     /note="contains seven copies of the tetracycline operator 
                     tetO"
     3'UTR           3508..4289
                     /label=K10
                     /note="K10"
     CDS             complement(4344..5360)
                     /codon_start=1
                     /gene="tTAV2"
                     /product="transactivator"
                     /label=tTAV2
                     /protein_id="AFS63391.1"
                     /translation="MGSRLDKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWH
                     VKNKRALLDALAIEMLDRHHTHFCPLEGESWQDFLRNNAKSFRCALLSHRDGAKVHLGT
                     RPTEKQYETLENQLAFLCQQGFSLENALYALSAVGHFTLGCVLEDQEHQVAKEERETPT
                     TDSMPPLLRQAIELFDHQGAEPAFLFGLELIICGLEKQLKCESGSGPAYSRARTKNNYG
                     STIEGLLDLPDDDAPEEAGLAAPRLSFLPAGHTRRLSTAPPTDVSLGDELHLDGEDVAM
                     AHADALDDFDLDMLGDGDSPGPGFTPHDSAPYGALDMADFEFEQMFTDALGIDEYGG"
     gene            complement(4344..5360)
                     /gene="tTAV2"
                     /label=tTAV2
     intron          5375..5444
                     /note="adh"
     regulatory      5451..5580
                     /regulatory_class="promoter"
                     /note="hsp70"
     regulatory      5586..6269
                     /regulatory_class="enhancer"
                     /note="tetO"
     protein_bind    5599..5869
                     /label=tetracycline response element
                     /bound_moiety="tetracycline repressor TetR"
                     /note="contains seven copies of the tetracycline operator 
                     tetO"
     protein_bind    5978..5996
                     /gene="tetO"
                     /label=tet operator
                     /bound_moiety="tetracycline repressor TetR"
                     /note="bacterial operator O2 for the tetR and tetA genes"
     protein_bind    5999..6017
                     /gene="tetO"
                     /label=tet operator
                     /bound_moiety="tetracycline repressor TetR"
                     /note="bacterial operator O2 for the tetR and tetA genes"
     protein_bind    6020..6038
                     /gene="tetO"
                     /label=tet operator
                     /bound_moiety="tetracycline repressor TetR"
                     /note="bacterial operator O2 for the tetR and tetA genes"
     protein_bind    6041..6059
                     /gene="tetO"
                     /label=tet operator
                     /bound_moiety="tetracycline repressor TetR"
                     /note="bacterial operator O2 for the tetR and tetA genes"
     protein_bind    6062..6080
                     /gene="tetO"
                     /label=tet operator
                     /bound_moiety="tetracycline repressor TetR"
                     /note="bacterial operator O2 for the tetR and tetA genes"
     protein_bind    6083..6101
                     /gene="tetO"
                     /label=tet operator
                     /bound_moiety="tetracycline repressor TetR"
                     /note="bacterial operator O2 for the tetR and tetA genes"
     protein_bind    6104..6122
                     /gene="tetO"
                     /label=tet operator
                     /bound_moiety="tetracycline repressor TetR"
                     /note="bacterial operator O2 for the tetR and tetA genes"
     protein_bind    6125..6143
                     /gene="tetO"
                     /label=tet operator
                     /bound_moiety="tetracycline repressor TetR"
                     /note="bacterial operator O2 for the tetR and tetA genes"
     protein_bind    6146..6164
                     /gene="tetO"
                     /label=tet operator
                     /bound_moiety="tetracycline repressor TetR"
                     /note="bacterial operator O2 for the tetR and tetA genes"
     protein_bind    6167..6185
                     /gene="tetO"
                     /label=tet operator
                     /bound_moiety="tetracycline repressor TetR"
                     /note="bacterial operator O2 for the tetR and tetA genes"
     protein_bind    6188..6206
                     /gene="tetO"
                     /label=tet operator
                     /bound_moiety="tetracycline repressor TetR"
                     /note="bacterial operator O2 for the tetR and tetA genes"
     protein_bind    6209..6227
                     /gene="tetO"
                     /label=tet operator
                     /bound_moiety="tetracycline repressor TetR"
                     /note="bacterial operator O2 for the tetR and tetA genes"
     protein_bind    6230..6248
                     /gene="tetO"
                     /label=tet operator
                     /bound_moiety="tetracycline repressor TetR"
                     /note="bacterial operator O2 for the tetR and tetA genes"
     protein_bind    6251..6269
                     /gene="tetO"
                     /label=tet operator
                     /bound_moiety="tetracycline repressor TetR"
                     /note="bacterial operator O2 for the tetR and tetA genes"
     regulatory      6346..7547
                     /regulatory_class="promoter"
                     /note="Hr5ie1"
     enhancer        6366..6848
                     /gene="Autographa californica hr5"
                     /label=hr5 enhancer
                     /note="baculovirus early transcription enhancer"
     intron          7562..7624
                     /note="scraps"
     regulatory      7643..7652
                     /regulatory_class="other"
                     /note="vertebrate consensus sequence for strong initiation 
                     of translation (Kozak, 1987)"
     regulatory      7658..7684
                     /regulatory_class="other"
                     /note="nuclear localization signal"
     regulatory      7691..7700
                     /regulatory_class="other"
                     /note="vertebrate consensus sequence for strong initiation 
                     of translation (Kozak, 1987)"
     CDS             7697..8413
                     /codon_start=1
                     /gene="DsRed2"
                     /product="DsRed2"
                     /label=DsRed2
                     /note="fluorescent protein"
                     /protein_id="AFS63392.1"
                     /translation="MASSENVITEFMRFKVRMEGTVNGHEFEIEGEGEGRPYEGHNTVK
                     LKVTKGGPLPFAWDILSPQFQYGSKVYVKHPADIPDYKKLSFPEGFKWERVMNFEDGGV
                     ATVTQDSSLQDGCFIYKVKFIGVNFPSDGPVMQKKTMGWEASTERLYPRDGVLKGETHK
                     ALKLKDGGHYLVEFKSIYMAKKPVQLPGYYYVDAKLDITSHNEDYTIVEQYERTEGRHH
                     LFLRSRPKKKRKVEDP"
     gene            7697..8413
                     /gene="DsRed2"
                     /label=DsRed2
     CDS             7697..8371
                     /codon_start=1
                     /product="improved tetrameric variant of DsRed fluorescent 
                     protein"
                     /label=DsRed2
                     /note="mammalian codon-optimized"
                     /translation="MASSENVITEFMRFKVRMEGTVNGHEFEIEGEGEGRPYEGHNTVK
                     LKVTKGGPLPFAWDILSPQFQYGSKVYVKHPADIPDYKKLSFPEGFKWERVMNFEDGGV
                     ATVTQDSSLQDGCFIYKVKFIGVNFPSDGPVMQKKTMGWEASTERLYPRDGVLKGETHK
                     ALKLKDGGHYLVEFKSIYMAKKPVQLPGYYYVDAKLDITSHNEDYTIVEQYERTEGRHH
                     LFL"
     regulatory      8377..8413
                     /regulatory_class="other"
                     /gene="DsRed2"
                     /note="nuclear localization signal"
     CDS             8381..8401
                     /codon_start=1
                     /product="nuclear localization signal of SV40 (simian virus
                     40) large T antigen"
                     /label=SV40 NLS
                     /translation="PKKKRKV"
     regulatory      8436..8663
                     /regulatory_class="polyA_signal_sequence"
                     /note="SV40"
     polyA_signal    8542..8663
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     protein_bind    8730..8829
                     /label=phage phi-C31 attP
                     /bound_moiety="phage phi-C31 integrase"
                     /note="attachment site of phage phi-C31"
     mobile_element  8996..10518
                     /mobile_element_type="transposon:piggyBac"

This page is informational only.