Cart 2

mKate_integration vector (V009843#)

Basic Vector Information

Basic Vector Information
Vector Name mKate_integration Length 3464 bp
Type Cloning vector Source Yu J, Pertusi D, Adeniran A, Tyo KEJ.

mKate_integration vector Vector Map

TRP1 ADH1 TDH3 TagRFP ADH1

mKate_integration vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported                3464 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector mKate_integration, complete sequence.
ACCESSION   KU904417
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3464)
  AUTHORS   Yu J, Pertusi D, Adeniran A, Tyo KEJ.
  TITLE     CellSort: A support vector machine algorithm for optimizing and 
            simulating FACS
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 3464)
  AUTHORS   Tyo KEJ., Adeniran A, Stainbrook SC, Bostick JW.
  TITLE     Direct Submission
  JOURNAL   Submitted (07-MAR-2016) Chemical and Biological Engineering, 
            Northwestern University, 2145 Sheridan Rd, Evanston, IL 60208, USA
REFERENCE   3  (bases 1 to 3464)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..3464
                     /organism="Cloning vector mKate_integration"
                     /mol_type="other DNA"
                     /label=derived from Saccharomyces cerevisiae sequence
                     /note="derived from Saccharomyces cerevisiae sequence"
                     /db_xref="taxon:1814216"
     gene            46..822
                     /gene="TRP1"
                     /label=TRP1
     regulatory      46..147
                     /regulatory_class="promoter"
                     /gene="TRP1"
     promoter        46..147
                     /gene="S. cerevisiae TRP1"
                     /label=TRP1 promoter
     CDS             148..822
                     /codon_start=1
                     /gene="TRP1"
                     /product="TRP1"
                     /label=TRP1
                     /protein_id="AMY56670.1"
                     /translation="MSVINFTGSSGPLVKVCGLQSTEAAECALDSDADLLGIICVPNRK
                     RTIDPVIARKISSLVKAYKNSSGTPKYLVGVFRNQPKEDVLALVNDYGIDIVQLHGDES
                     WQEYQEFLGLPVIKRLVFPKDCNILLSAASQKPHSFIPLFDSEAGGTGELLDWNSISDW
                     VGRQESPESLHFMLAGGLTPENVGDALRLNGVIGVDVSGGVETNGVKDSNKIANFVKNA
                     KK"
     rep_origin      661..1498
                     /note="Saccharomyces cerevisiae autonomously replicating 
                     sequence ARS1/ARS416"
     regulatory      1499..1686
                     /regulatory_class="terminator"
                     /gene="ADH1"
     gene            1499..1686
                     /gene="ADH1"
                     /label=ADH1
     terminator      1499..1686
                     /gene="S. cerevisiae ADH1"
                     /label=ADH1 terminator
                     /note="transcription terminator for the S. cerevisiae 
                     alcohol dehydrogenase 1 (ADH1) gene"
     regulatory      1819..2454
                     /regulatory_class="promoter"
                     /gene="TDH3"
     gene            1819..2454
                     /gene="TDH3"
                     /label=TDH3
     CDS             2467..3177
                     /codon_start=1
                     /product="TagRFP"
                     /label=TagRFP
                     /note="monomeric derivative of red fluorescent protein from
                     Entacmaea quadricolor (Merzlyak et al., 2007)"
                     /protein_id="AMY56669.1"
                     /translation="MSKGEELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMR
                     IKVVEGGPLPFAFDILATSFMYGSKTFINHTQGIPDFFKQSFPEGFTWERVTTYEDGGV
                     LTATQDTSLQDGCLIYNVKIRGVNFPSNGPVMQKKTLGWEASTEMLYPADGGLEGRSDM
                     ALKLVGGGHLICNLKTTYRSKKPAKNLKMPGVYYVDRRLERIKEADKETYVEQHEVAVA
                     RYCDLPSKLGHKLN"
     regulatory      3198..3385
                     /regulatory_class="terminator"
                     /gene="ADH1"
     gene            3198..3385
                     /gene="ADH1"
                     /label=ADH1
     terminator      3198..3385
                     /gene="S. cerevisiae ADH1"
                     /label=ADH1 terminator
                     /note="transcription terminator for the S. cerevisiae 
                     alcohol dehydrogenase 1 (ADH1) gene"

This page is informational only.