Cart 2

mini-Tn4001tet vector (V009846#)

Basic Vector Information

Basic Vector Information
Vector Name mini-Tn4001tet Length 3475 bp
Type Cloning vector Source Pour-El I, Adams CJ, Minion C.

mini-Tn4001tet vector Vector Map

tnp tet(M)

mini-Tn4001tet vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported                3475 bp ds-DNA     circular SYN 14-DEC-2018
DEFINITION  Cloning vector mini-Tn4001tet, complete sequence.
ACCESSION   AY047229
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3475)
  AUTHORS   Pour-El I, Adams CJ, Minion C.
  TITLE     Construction of mini-Tn4001tet and its use in Mycoplasma 
            gallisepticum
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 3475)
  AUTHORS   Minion C.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-JUL-2001) Vet. Med. Res. Inst., Iowa State University,
            VMRI, 1802 Elwood Drive, Ames, IA 50011, USA
REFERENCE   3  (bases 1 to 3475)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..3475
                     /organism="Cloning vector mini-Tn4001tet"
                     /lab_host="Staphylococcus aureus"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:171614"
     gene            90..1262
                     /gene="tnp"
                     /label=tnp
     CDS             90..1262
                     /codon_start=1
                     /gene="tnp"
                     /product="transposase"
                     /label=tnp
                     /protein_id="AAL05909.1"
                     /translation="MTQVHFTLKSEEIQSIIEYSVKDDVSKNILTTVFNQLMENQRTEY
                     IQAKEYERTENRQSQRNGYYERSFTTRVGTLELKVPRTRDGHFSPTVFERYQRNEKALM
                     ASMLEMYVSGVSTRKVSKIVEELCGKSVSKSFVSSLTEQLEPMVNEWQNRLLSEKNYPY
                     LMTDVLYIKVREENRVLSKSCHIAIGITKDGDREIIGFMIQSGESEETWTTFFEYLKER
                     GLQGTELVISDAHKGLVSAIRKSFTNVSWQRCQVHFLRNIFTTIPKKNSKSFREAVKGI
                     FKFTDINLAREAKNRLIHDYIDQPKYSKACASLDDGFEDAFQYTVQGNSHNRLKSTNLI
                     ERLNQEVRRREKIIRIFPNQTSANRLIGAVLMDLHDEWIYSSRKYINFDK"
     repeat_region   1283..1308
     gene            1450..3369
                     /gene="tet(M)"
                     /label=tet(M)
     CDS             1450..3369
                     /codon_start=1
                     /gene="tet(M)"
                     /product="tetracycline resistence protein"
                     /label=tet(M)
                     /note="Tet(M)"
                     /protein_id="AAL05910.1"
                     /translation="MKIINIGVLAHVDAGKTTLTESLLYNSGAITELGSVDKGTTRTDN
                     TLLERQRGITIQTGITSFQWENTKVNIIDTPGHMDFLAEVYRSLSVLDGAILLISAKDG
                     VQAQTRILFHALRKMGIPTIFFINKIDQNGIDLSTVYQDIKEKLSAEIVIKQKVELYPN
                     VCVTNFTESEQWDTVIEGNDDLLEKYMSGKSLEALELEQEESIRFQNCSLFPLYHGSAK
                     SNIGIDNLIEVITNKFYSSTHRGPSELCGNVFKIEYTKKRQRLAYIRLYSGVLHLRDSV
                     RVSEKEKIKVTEMYTSINGELCKIDRAYSGEIVILQNEFLKLNSVLGDTKLLPQRKKIE
                     NPHPLLQTTVEPSKPEQREMLLDALLEISDSDPLLRYYVDSTTHEIILSFLGKVQMEVI
                     SALLQEKYHVEIEITEPTVIYMERPLKNAEYTIHIEVPPNPFWASIGLSVSPLPLGSGM
                     QYESSVSLGYLNQSFQNAVMEGIRYGCEQGLYGWNVTDCKICFKYGLYYSPVSTPADFR
                     MLAPIVLEQVLKKAGTELLEPYLSFKIYAPQEYLSRAYNDAPKYCANIVDTQLKNNEVI
                     LSGEIPARCIQEYRSDLTFFTNGRSVCLTELKGYHVTTGEPVCQPRRPNSRIDKVRYMF
                     NKIT"
     repeat_region   3444..3469

This page is informational only.